BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305G01f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g44620.1 68416.m04797 low molecular weight phosphotyrosine pr... 82 2e-16 At2g36800.1 68415.m04513 UDP-glucoronosyl/UDP-glucosyl transfera... 32 0.27 At4g15100.1 68417.m02321 serine carboxypeptidase S10 family prot... 30 1.1 At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.1 At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.4 At2g40935.2 68415.m05054 expressed protein low similarity to PGP... 29 1.9 At2g40935.1 68415.m05053 expressed protein low similarity to PGP... 29 1.9 At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.9 At4g01780.1 68417.m00233 XH/XS domain-containing protein contain... 29 2.5 At2g36790.1 68415.m04512 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.5 At5g25420.1 68418.m03016 xanthine/uracil permease family protein... 28 4.4 At4g32600.1 68417.m04642 zinc finger (C3HC4-type RING finger) fa... 28 4.4 At4g26130.1 68417.m03761 expressed protein 28 4.4 At1g65550.1 68414.m07436 xanthine/uracil permease family protein... 28 4.4 At4g33410.1 68417.m04748 signal peptide peptidase family protein... 27 5.8 At4g13420.1 68417.m02095 potassium transporter (HAK5) identical ... 27 5.8 At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.7 >At3g44620.1 68416.m04797 low molecular weight phosphotyrosine protein phosphatase family protein contains Pfam profile: PF01451 low molecular weight phosphotyrosine protein phosphatase Length = 177 Score = 82.2 bits (194), Expect = 2e-16 Identities = 45/118 (38%), Positives = 64/118 (54%) Frame = +2 Query: 167 LFICLGNICRSPIAEAVFQKTVNDMNLGEHWDIDSAAIGGWHVGNPPDWRALDTLKKHNV 346 LF+CLGNICRSP AE VF+ V L ++IDSA +H GN D R K+ + Sbjct: 18 LFVCLGNICRSPAAEGVFRDIVKKRGLDSKFNIDSAGTIDYHEGNMADPRMRSAAKRRGI 77 Query: 347 PYNNHARQITSEDFDYYDYIFGMDESNMKDLNKKAPKGSKAKLLLFGDFDPQGDRIIR 520 + +R I + DF +D I MD+ N +D+ KA KA+ G+F P D+ ++ Sbjct: 78 EITSLSRPIKASDFREFDLILAMDDQNKEDI-LKAYNVWKAR----GNFPPDADKKVK 130 >At2g36800.1 68415.m04513 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 495 Score = 31.9 bits (69), Expect = 0.27 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 104 GNQRESSIKLALKMVDHKK--KALFICLGNICRSPIAE 211 GN+ + LK +D KK L++CLG+IC P+++ Sbjct: 267 GNKSDIDQDECLKWLDSKKHGSVLYVCLGSICNLPLSQ 304 >At4g15100.1 68417.m02321 serine carboxypeptidase S10 family protein similar to Serine carboxypeptidase II chains A and B (SP:P08819) (EC 3.4.16.6) [Triticum aestivum (Wheat)] Length = 407 Score = 29.9 bits (64), Expect = 1.1 Identities = 21/82 (25%), Positives = 33/82 (40%), Gaps = 4/82 (4%) Frame = +2 Query: 140 KMVDHKKKALFIC---LGNICRSPIAEAVFQKTVNDMNLGEHWDIDSAAIGGWHVGNPPD 310 K +HK +I I +AE V+ + +L H ++ +G + NP D Sbjct: 96 KFPEHKGNEFYIAGESYAGIYVPELAELVYDNNEKNNDLSLHINLKGFLLGNPDISNPDD 155 Query: 311 WRA-LDTLKKHNVPYNNHARQI 373 WR +D H V + R I Sbjct: 156 WRGWVDYAWSHAVISDETHRNI 177 >At2g36750.1 68415.m04508 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 491 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/38 (31%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +2 Query: 104 GNQRESSIKLALKMVDHKKKA--LFICLGNICRSPIAE 211 GN+ + +K +D K++ L++CLG+IC P+++ Sbjct: 263 GNKADIDQDECIKWLDSKEEGSVLYVCLGSICNLPLSQ 300 >At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 104 GNQRESSIKLALKMVDHK--KKALFICLGNICRSPIAE 211 GN+ +K +D K + L++CLG+IC P+A+ Sbjct: 268 GNKAAIDQDECIKWLDSKDVESVLYVCLGSICNLPLAQ 305 >At2g40935.2 68415.m05054 expressed protein low similarity to PGPS/D12 [Petunia x hybrida] GI:4105794; contains Pfam profile PF04749: Protein of unknown function, DUF614 Length = 166 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 369 CLAWLLYGTLCFFKVSSALQSGGLPTC 289 C++W L T+C F + AL GLP C Sbjct: 68 CISWALVNTICCFATNGALL--GLPGC 92 >At2g40935.1 68415.m05053 expressed protein low similarity to PGPS/D12 [Petunia x hybrida] GI:4105794; contains Pfam profile PF04749: Protein of unknown function, DUF614 Length = 190 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 369 CLAWLLYGTLCFFKVSSALQSGGLPTC 289 C++W L T+C F + AL GLP C Sbjct: 92 CISWALVNTICCFATNGALL--GLPGC 116 >At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 104 GNQRESSIKLALKMVDHKK--KALFICLGNICRSPIAE 211 GNQ L+ +D K+ L++CLG+IC P+++ Sbjct: 268 GNQAAIDQDECLQWLDSKEDGSVLYVCLGSICNLPLSQ 305 >At4g01780.1 68417.m00233 XH/XS domain-containing protein contains Pfam profiles PF03469: XH domain, PF03468: XS domain Length = 456 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 4/66 (6%) Frame = +2 Query: 158 KKALFICLGNICRSPIAEAVFQKTVNDMNLGEHWDIDSAAIGG---W-HVGNPPDWRALD 325 +K L C+G + R P +A+ QK + D++ A+ W H N PDW Sbjct: 315 RKELVNCMGELVRKPFVDAMQQKYCQE-------DVEDRAVEVLQLWEHYINDPDWHPYK 367 Query: 326 TLKKHN 343 +K N Sbjct: 368 RVKLEN 373 >At2g36790.1 68415.m04512 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 495 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/38 (31%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 104 GNQRESSIKLALKMVDHKK--KALFICLGNICRSPIAE 211 GN+ + L+ +D K+ L++CLG+IC P+++ Sbjct: 267 GNKSDIDQDECLEWLDSKEPGSVLYVCLGSICNLPLSQ 304 >At5g25420.1 68418.m03016 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 419 Score = 27.9 bits (59), Expect = 4.4 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -1 Query: 449 LFCSNLSYWIHPYQRYNHNNRSLQKLFVLHGC 354 ++ + +Y+ P++R+ RS+Q ++ GC Sbjct: 131 IYSTRFTYYTDPFERFVRTMRSIQGALIITGC 162 >At4g32600.1 68417.m04642 zinc finger (C3HC4-type RING finger) family protein low similarity to RING finger protein 38 [Homo sapiens] GI:21666412; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 453 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 424 GFIHTKDIIIIIEVFRSYLSCMVVVWNVM 338 GFI + +I+E F+ L C VW V+ Sbjct: 217 GFISAARLKVIVEYFKMALDCFFAVWFVV 245 >At4g26130.1 68417.m03761 expressed protein Length = 286 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +2 Query: 299 NPPDWRALDTLKKHNVPYNNHARQITSEDFDYYDYIFGMDESNMKDLNKKAPK 457 NPP L +K N+PY + + D+ Y+ + DE+N D K P+ Sbjct: 96 NPPP-SLLQRVKSINMPYFKFPQHNSEGDYAAYELMTQPDETNRVDPIDKIPE 147 >At1g65550.1 68414.m07436 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 541 Score = 27.9 bits (59), Expect = 4.4 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -1 Query: 449 LFCSNLSYWIHPYQRYNHNNRSLQKLFVLHGC 354 ++ + +Y+ P++R+ RS+Q ++ GC Sbjct: 119 IYSTRFTYYTDPFERFVRTMRSIQGALIITGC 150 >At4g33410.1 68417.m04748 signal peptide peptidase family protein contains Pfam domain PF04258: Membrane protein of unknown function (DUF435) Length = 372 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 440 SNLSYWIHPYQRYNHNNRSLQKLFVLHGCCMERYASSKYLVL 315 S+L YW+ PY Y L F L CC + + + L+L Sbjct: 93 SSLFYWLSPYAVYMKTQLGLSDPF-LSRCCSKSFTRIQGLLL 133 >At4g13420.1 68417.m02095 potassium transporter (HAK5) identical to K+ transporter HAK5 [Arabidopsis thaliana] gi|7108597|gb|AAF36490; similar to high-affinity potassium transporter AtKUP1p [Arabidopsis thaliana] gi|2688979|gb|AAB88901; KUP/HAK/KT Transporter family member, PMID:11500563 Length = 785 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = -2 Query: 427 IGFIHTKDIIIIIEVFRSYLSCMVVVWNVMLLQSI*CSPIGRIT 296 IG +T+ + I +F Y+S + V +V +L SI P+ R+T Sbjct: 559 IGLFYTELVNGITPLFSHYISNLSSVHSVFVLISIKTLPVNRVT 602 >At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/27 (37%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = +2 Query: 137 LKMVDHKKKA--LFICLGNICRSPIAE 211 L+ +D K++ L++CLG+IC P+++ Sbjct: 279 LQWLDSKEEGSVLYVCLGSICNLPLSQ 305 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,308,061 Number of Sequences: 28952 Number of extensions: 243998 Number of successful extensions: 588 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -