BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305F08f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 23 1.6 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 6.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 6.6 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 6.6 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 8.7 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 23.0 bits (47), Expect = 1.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 144 ILDHLTDVLSGVGVCDLI 91 IL H+ SG+ +CDLI Sbjct: 252 ILWHIVGTFSGIFLCDLI 269 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 480 AWSLSIFVLAFSAFXPVDVLHEHTLVLEHITLRLH 376 +W++ I ++ + D+L HT HI L+ Sbjct: 185 SWAVGIGIMLAQYYLQADMLLWHTFGYYHILAMLN 219 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 6.6 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = -1 Query: 140 LIILRMFCLELVFAISLISFGSNHTFFLPHRITEAASLFC 21 L I +C ++F + L+ + FF I LFC Sbjct: 144 LCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTMHLLFC 183 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 480 AWSLSIFVLAFSAFXPVDVLHEHTLVLEHITLRLH 376 +W++ I ++ + D+L HT HI L+ Sbjct: 185 SWAVGIGIMLAQYYLQADMLLWHTFGYYHILAMLN 219 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 Query: 267 TRIGCTSSLTKATVTTLSTC 208 TRI T S T TL TC Sbjct: 42 TRISSTVSRNTDTYPTLETC 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,676 Number of Sequences: 336 Number of extensions: 2908 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -