SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS305F07f
         (521 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protei...    23   1.4  
DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholi...    21   5.8  
DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholi...    21   5.8  
AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor ...    21   7.7  

>AF469010-1|AAL93136.1|  678|Apis mellifera cGMP-dependent protein
           kinase foraging protein.
          Length = 678

 Score = 23.4 bits (48), Expect = 1.4
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = +2

Query: 146 GDFKGHQENRNGDLVTGSYSVVDPDGTRRIV 238
           GDF G +  +  DL T +    DP+G   +V
Sbjct: 286 GDFFGEKALQGDDLRTANIIADDPEGVSCLV 316


>DQ026034-1|AAY87893.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -2

Query: 256 GVSCIIHDPP 227
           G SC+IH PP
Sbjct: 431 GGSCLIHGPP 440


>DQ026033-1|AAY87892.1|  569|Apis mellifera nicotinic acetylcholine
           receptor alpha4subunit protein.
          Length = 569

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -2

Query: 256 GVSCIIHDPP 227
           G SC+IH PP
Sbjct: 431 GGSCLIHGPP 440


>AB267886-1|BAF46356.1|  567|Apis mellifera ecdysteroid receptor A
           isoform protein.
          Length = 567

 Score = 21.0 bits (42), Expect = 7.7
 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%)
 Frame = +2

Query: 104 PQYS-YGYDVQDTLTGDFKGHQENRNGDLVTGSYSVVDP 217
           PQ+  YG   Q  L  + +  Q++ NG     S S  DP
Sbjct: 105 PQHVVYGNPQQQQLAAETQQQQQHNNGYASPMSTSSYDP 143


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 119,738
Number of Sequences: 438
Number of extensions: 2155
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -