BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305F07f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 1.4 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 5.8 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 5.8 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.7 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 146 GDFKGHQENRNGDLVTGSYSVVDPDGTRRIV 238 GDF G + + DL T + DP+G +V Sbjct: 286 GDFFGEKALQGDDLRTANIIADDPEGVSCLV 316 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 256 GVSCIIHDPP 227 G SC+IH PP Sbjct: 431 GGSCLIHGPP 440 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 256 GVSCIIHDPP 227 G SC+IH PP Sbjct: 431 GGSCLIHGPP 440 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 7.7 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 104 PQYS-YGYDVQDTLTGDFKGHQENRNGDLVTGSYSVVDP 217 PQ+ YG Q L + + Q++ NG S S DP Sbjct: 105 PQHVVYGNPQQQQLAAETQQQQQHNNGYASPMSTSSYDP 143 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,738 Number of Sequences: 438 Number of extensions: 2155 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -