BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305E08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14262| Best HMM Match : DUF999 (HMM E-Value=1.1) 29 2.3 SB_38029| Best HMM Match : PqqD (HMM E-Value=1.1) 28 4.1 >SB_14262| Best HMM Match : DUF999 (HMM E-Value=1.1) Length = 505 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 185 FLSRARSTIEDKIFSRYVSIRTTKLKKFYK 274 F + +ST + +F+R+ S+ T+LK F+K Sbjct: 168 FAVKCKSTAQAMVFNRFFSVFATELKGFFK 197 >SB_38029| Best HMM Match : PqqD (HMM E-Value=1.1) Length = 215 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 82 IKFHHIIGLTDLTKNLYLPARNYSLKLSVII 174 I FH +G LT+ YL A Y+LK + ++ Sbjct: 40 ISFHQFLGKLQLTEENYLLALRYTLKRTTLL 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,503,812 Number of Sequences: 59808 Number of extensions: 230022 Number of successful extensions: 380 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -