BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305E08f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z71178-6|CAA94880.2| 1185|Caenorhabditis elegans Hypothetical pr... 34 0.071 >Z71178-6|CAA94880.2| 1185|Caenorhabditis elegans Hypothetical protein B0024.8 protein. Length = 1185 Score = 33.9 bits (74), Expect = 0.071 Identities = 17/43 (39%), Positives = 28/43 (65%) Frame = +3 Query: 102 RVDGLNQKFVPTRAELQPEIISDYLKQVSYLELDQLLRIRSSL 230 +VDGLN + T +E QP +++D LK+V L++ +RSS+ Sbjct: 721 KVDGLNM--ISTLSETQPRMVADNLKEVIIAILNECKNLRSSV 761 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,334,584 Number of Sequences: 27780 Number of extensions: 184104 Number of successful extensions: 286 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 283 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 286 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -