BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305E05f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y08416-1|CAA69693.1| 498|Homo sapiens nicotinic acetylcholine r... 34 0.26 X68275-1|CAA48336.1| 451|Homo sapiens nicotinic receptor beta 4... 34 0.26 U62439-1|AAB40117.1| 498|Homo sapiens nicotinic acetylcholine r... 34 0.26 U48861-1|AAA92123.1| 498|Homo sapiens beta 4 nicotinic acetylch... 34 0.26 BC096082-1|AAH96082.1| 498|Homo sapiens cholinergic receptor, n... 34 0.26 BC096080-1|AAH96080.1| 498|Homo sapiens cholinergic receptor, n... 34 0.26 AJ306454-1|CAC34819.1| 497|Homo sapiens neuronal nicotinic acet... 34 0.26 AF306329-1|AAL02062.1| 498|Homo sapiens neuronal nicotinic acet... 34 0.26 Y08415-1|CAA69692.1| 502|Homo sapiens nicotinic acetylcholine r... 30 4.3 X53179-1|CAA37320.1| 502|Homo sapiens precursor peptide (AA -25... 30 4.3 U62437-1|AAB40115.1| 502|Homo sapiens nicotinic acetylcholine r... 30 4.3 L37368-1|AAA92859.1| 305|Homo sapiens RNA-binding protein protein. 30 4.3 BC108316-1|AAI08317.1| 305|Homo sapiens RNA binding protein S1,... 30 4.3 BC075041-1|AAH75041.1| 502|Homo sapiens cholinergic receptor, n... 30 4.3 BC075040-1|AAH75040.1| 502|Homo sapiens cholinergic receptor, n... 30 4.3 BC001838-1|AAH01838.1| 305|Homo sapiens RNA binding protein S1,... 30 4.3 BC001659-1|AAH01659.1| 305|Homo sapiens RNA binding protein S1,... 30 4.3 AL592078-3|CAI16184.1| 502|Homo sapiens cholinergic receptor, n... 30 4.3 AJ001935-1|CAA05108.1| 504|Homo sapiens CHRNB2 protein. 30 4.3 AF274003-1|AAL56665.1| 282|Homo sapiens splicing-related factor... 30 4.3 AF247662-1|AAF72519.1| 228|Homo sapiens SR-related protein LD2 ... 30 4.3 AF077186-1|AAD45422.1| 502|Homo sapiens neuronal nicotinic acet... 30 4.3 AF015608-1|AAC39791.1| 305|Homo sapiens SR protein protein. 30 4.3 Y12661-1|CAA73210.1| 616|Homo sapiens neuro-endocrine specific ... 30 5.7 X01715-1|CAA25861.1| 520|Homo sapiens acetylcholine receptor ga... 30 5.7 BC111802-1|AAI11803.1| 465|Homo sapiens CHRNG protein protein. 30 5.7 AC092165-3|AAY24103.1| 520|Homo sapiens unknown protein. 30 5.7 X55019-1|CAA38759.1| 517|Homo sapiens acetylcholine receptor de... 29 7.5 BX537838-1|CAD97850.1| 1410|Homo sapiens hypothetical protein pr... 29 7.5 BC093925-1|AAH93925.1| 517|Homo sapiens cholinergic receptor, n... 29 7.5 BC093923-1|AAH93923.1| 517|Homo sapiens cholinergic receptor, n... 29 7.5 AC092165-2|AAY24102.1| 517|Homo sapiens unknown protein. 29 7.5 BC063835-1|AAH63835.1| 615|Homo sapiens VGF nerve growth factor... 29 9.9 AC004876-3|AAD45830.1| 615|Homo sapiens WUGSC:H_DJ0747G18.3 pro... 29 9.9 >Y08416-1|CAA69693.1| 498|Homo sapiens nicotinic acetylcholine receptor beta4 subunit precursor protein. Length = 498 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 217 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 253 >X68275-1|CAA48336.1| 451|Homo sapiens nicotinic receptor beta 4 subunit protein. Length = 451 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 170 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 206 >U62439-1|AAB40117.1| 498|Homo sapiens nicotinic acetylcholine receptor beta4 subunit precursor protein. Length = 498 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 217 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 253 >U48861-1|AAA92123.1| 498|Homo sapiens beta 4 nicotinic acetylcholine receptor subunit protein. Length = 498 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 217 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 253 >BC096082-1|AAH96082.1| 498|Homo sapiens cholinergic receptor, nicotinic, beta 4 protein. Length = 498 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 217 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 253 >BC096080-1|AAH96080.1| 498|Homo sapiens cholinergic receptor, nicotinic, beta 4 protein. Length = 498 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 217 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 253 >AJ306454-1|CAC34819.1| 497|Homo sapiens neuronal nicotinic acetylcholine receptor beta-4 subunit protein. Length = 497 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 216 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 252 >AF306329-1|AAL02062.1| 498|Homo sapiens neuronal nicotinic acetylcholine receptor beta 4 subunit protein. Length = 498 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 256 PSHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 PS+VD+ Y+ + KPLFYT N II VL L + V Sbjct: 217 PSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILV 253 >Y08415-1|CAA69692.1| 502|Homo sapiens nicotinic acetylcholine receptor beta2 subunit precursor protein. Length = 502 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >X53179-1|CAA37320.1| 502|Homo sapiens precursor peptide (AA -25 to 477) protein. Length = 502 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >U62437-1|AAB40115.1| 502|Homo sapiens nicotinic acetylcholine receptor beta2 subunit precursor protein. Length = 502 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >L37368-1|AAA92859.1| 305|Homo sapiens RNA-binding protein protein. Length = 305 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 260 AGWLRAPPEELSPPRALPAPVPQSRAS 340 A W R PP SPPR + P P R S Sbjct: 240 APWPRPPPRRFSPPRRMLPPPPMWRRS 266 >BC108316-1|AAI08317.1| 305|Homo sapiens RNA binding protein S1, serine-rich domain protein. Length = 305 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 260 AGWLRAPPEELSPPRALPAPVPQSRAS 340 A W R PP SPPR + P P R S Sbjct: 240 APWPRPPPRRFSPPRRMLPPPPMWRRS 266 >BC075041-1|AAH75041.1| 502|Homo sapiens cholinergic receptor, nicotinic, beta 2 (neuronal) protein. Length = 502 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >BC075040-1|AAH75040.1| 502|Homo sapiens cholinergic receptor, nicotinic, beta 2 (neuronal) protein. Length = 502 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >BC001838-1|AAH01838.1| 305|Homo sapiens RNA binding protein S1, serine-rich domain protein. Length = 305 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 260 AGWLRAPPEELSPPRALPAPVPQSRAS 340 A W R PP SPPR + P P R S Sbjct: 240 APWPRPPPRRFSPPRRMLPPPPMWRRS 266 >BC001659-1|AAH01659.1| 305|Homo sapiens RNA binding protein S1, serine-rich domain protein. Length = 305 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 260 AGWLRAPPEELSPPRALPAPVPQSRAS 340 A W R PP SPPR + P P R S Sbjct: 240 APWPRPPPRRFSPPRRMLPPPPMWRRS 266 >AL592078-3|CAI16184.1| 502|Homo sapiens cholinergic receptor, nicotinic, beta 2 (neuronal) protein. Length = 502 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >AJ001935-1|CAA05108.1| 504|Homo sapiens CHRNB2 protein. Length = 504 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >AF274003-1|AAL56665.1| 282|Homo sapiens splicing-related factor RNPS1 protein. Length = 282 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 260 AGWLRAPPEELSPPRALPAPVPQSRAS 340 A W R PP SPPR + P P R S Sbjct: 217 APWPRPPPRRFSPPRRMLPPPPMWRRS 243 >AF247662-1|AAF72519.1| 228|Homo sapiens SR-related protein LD2 protein. Length = 228 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 260 AGWLRAPPEELSPPRALPAPVPQSRAS 340 A W R PP SPPR + P P R S Sbjct: 163 APWPRPPPRRFSPPRRMLPPPPMWRRS 189 >AF077186-1|AAD45422.1| 502|Homo sapiens neuronal nicotinic acetylcholine receptor beta 2 protein. Length = 502 Score = 30.3 bits (65), Expect = 4.3 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 253 SHVDIPYNILDTDKPLFYT-NNIISTVLYNFLPLTV 149 ++VDI Y+ + KPLFYT N II VL L + V Sbjct: 220 TYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILV 255 >AF015608-1|AAC39791.1| 305|Homo sapiens SR protein protein. Length = 305 Score = 30.3 bits (65), Expect = 4.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 260 AGWLRAPPEELSPPRALPAPVPQSRAS 340 A W R PP SPPR + P P R S Sbjct: 240 APWPRPPPRRFSPPRRMLPPPPMWRRS 266 >Y12661-1|CAA73210.1| 616|Homo sapiens neuro-endocrine specific protein VGF protein. Length = 616 Score = 29.9 bits (64), Expect = 5.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 Query: 272 RAPPEELSPPRALPAP 319 +APPE + PPRA PAP Sbjct: 486 KAPPEPVPPPRAAPAP 501 >X01715-1|CAA25861.1| 520|Homo sapiens acetylcholine receptor gamma chain precursor protein. Length = 520 Score = 29.9 bits (64), Expect = 5.7 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 268 PARAPSHVDIPYNILDTDKPLFYTNNIIS-TVLYNFLPLTVH 146 PA+ H + + +L KPLFY NII+ VL + + + +H Sbjct: 225 PAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIH 266 >BC111802-1|AAI11803.1| 465|Homo sapiens CHRNG protein protein. Length = 465 Score = 29.9 bits (64), Expect = 5.7 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 268 PARAPSHVDIPYNILDTDKPLFYTNNIIS-TVLYNFLPLTVH 146 PA+ H + + +L KPLFY NII+ VL + + + +H Sbjct: 170 PAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIH 211 >AC092165-3|AAY24103.1| 520|Homo sapiens unknown protein. Length = 520 Score = 29.9 bits (64), Expect = 5.7 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -2 Query: 268 PARAPSHVDIPYNILDTDKPLFYTNNIIS-TVLYNFLPLTVH 146 PA+ H + + +L KPLFY NII+ VL + + + +H Sbjct: 225 PAQEAGHQKVVFYLLIQRKPLFYVINIIAPCVLISSVAILIH 266 >X55019-1|CAA38759.1| 517|Homo sapiens acetylcholine receptor delta subunit protein. Length = 517 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 268 PARAPSHVDIPYNILDTDKPLFYTNNI-ISTVLYNFL 161 P +PS DI + ++ KPLFY NI + VL +F+ Sbjct: 227 PLDSPSRQDITFYLIIRRKPLFYIINILVPCVLISFM 263 >BX537838-1|CAD97850.1| 1410|Homo sapiens hypothetical protein protein. Length = 1410 Score = 29.5 bits (63), Expect = 7.5 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = +2 Query: 257 SAGWLRAPPEELSPPRALPAPVPQSRASVF*GPSHRTFVAGKDLITK 397 SAG A PEEL P A P P S A+ P+H +A L+T+ Sbjct: 889 SAGATPAEPEELLTPLAPALPSPASTATPPPTPTHPQALALPPLVTE 935 >BC093925-1|AAH93925.1| 517|Homo sapiens cholinergic receptor, nicotinic, delta protein. Length = 517 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 268 PARAPSHVDIPYNILDTDKPLFYTNNI-ISTVLYNFL 161 P +PS DI + ++ KPLFY NI + VL +F+ Sbjct: 227 PLDSPSRQDITFYLIIRRKPLFYIINILVPCVLISFM 263 >BC093923-1|AAH93923.1| 517|Homo sapiens cholinergic receptor, nicotinic, delta protein. Length = 517 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 268 PARAPSHVDIPYNILDTDKPLFYTNNI-ISTVLYNFL 161 P +PS DI + ++ KPLFY NI + VL +F+ Sbjct: 227 PLDSPSRQDITFYLIIRRKPLFYIINILVPCVLISFM 263 >AC092165-2|AAY24102.1| 517|Homo sapiens unknown protein. Length = 517 Score = 29.5 bits (63), Expect = 7.5 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 268 PARAPSHVDIPYNILDTDKPLFYTNNI-ISTVLYNFL 161 P +PS DI + ++ KPLFY NI + VL +F+ Sbjct: 227 PLDSPSRQDITFYLIIRRKPLFYIINILVPCVLISFM 263 >BC063835-1|AAH63835.1| 615|Homo sapiens VGF nerve growth factor inducible protein. Length = 615 Score = 29.1 bits (62), Expect = 9.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 275 APPEELSPPRALPAP 319 APPE + PPRA PAP Sbjct: 486 APPEPVPPPRAAPAP 500 >AC004876-3|AAD45830.1| 615|Homo sapiens WUGSC:H_DJ0747G18.3 protein. Length = 615 Score = 29.1 bits (62), Expect = 9.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +2 Query: 275 APPEELSPPRALPAP 319 APPE + PPRA PAP Sbjct: 486 APPEPVPPPRAAPAP 500 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 64,494,275 Number of Sequences: 237096 Number of extensions: 1178102 Number of successful extensions: 3937 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 3650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3936 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -