BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305E05f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81481-2|CAB03948.1| 593|Caenorhabditis elegans Hypothetical pr... 29 1.5 AL032644-7|CAA21670.1| 354|Caenorhabditis elegans Hypothetical ... 29 2.7 U00050-10|AAA50701.1| 153|Caenorhabditis elegans Myosin light c... 27 8.1 L03412-1|AAA28112.1| 153|Caenorhabditis elegans alkali myosin l... 27 8.1 AF000198-6|AAB53056.2| 526|Caenorhabditis elegans Calcium chann... 27 8.1 >Z81481-2|CAB03948.1| 593|Caenorhabditis elegans Hypothetical protein C38D9.2 protein. Length = 593 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 148 VQSKVESCTKQLILCCSYKKGVCPYLRCYTGCRRGWE 258 V VE C Q+ C + C Y + G +RGW+ Sbjct: 520 VYEPVEFCGAQMHTNCPSEDSFCKYCKALRGTQRGWK 556 >AL032644-7|CAA21670.1| 354|Caenorhabditis elegans Hypothetical protein Y51H1A.7 protein. Length = 354 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 269 LRAPPEELSPPRALPAPVPQSRASV 343 LRAP EE PP A APVP ++ Sbjct: 211 LRAPLEEEKPPVATMAPVPDEHKAI 235 >U00050-10|AAA50701.1| 153|Caenorhabditis elegans Myosin light chain protein 3, isoforma protein. Length = 153 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 477 EDDDGMIPYAAFLKKVMA 424 ED +GM+ Y F+KKV+A Sbjct: 129 EDGEGMVKYEDFIKKVLA 146 >L03412-1|AAA28112.1| 153|Caenorhabditis elegans alkali myosin light chain protein. Length = 153 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 477 EDDDGMIPYAAFLKKVMA 424 ED +GM+ Y F+KKV+A Sbjct: 129 EDGEGMVKYEDFIKKVLA 146 >AF000198-6|AAB53056.2| 526|Caenorhabditis elegans Calcium channel, beta subunit protein1 protein. Length = 526 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 254 GSAGWLRAPPEELSPPRALPAPVPQSRAS 340 GS G ++ P++ P ++ P P PQ + S Sbjct: 473 GSYGGMQQQPQQQQPMQSAPPPAPQRQTS 501 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,311,018 Number of Sequences: 27780 Number of extensions: 191790 Number of successful extensions: 644 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 640 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -