BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D11f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.41 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.2 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 23 2.2 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 22 2.9 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 5.0 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 6.6 AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical pro... 21 6.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.0 bits (52), Expect = 0.41 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 152 DYGLFQINDRYWCSKGASPGK 214 DY + YW KGA PGK Sbjct: 2538 DYFNANFSLNYWIEKGADPGK 2558 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 1.2 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 41 LRKHGFEEN-LMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQ 169 L K N +R ++C E E+ SK N G+K L++ Sbjct: 320 LEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLADLYK 363 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 1.2 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 41 LRKHGFEEN-LMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQ 169 L K N +R ++C E E+ SK N G+K L++ Sbjct: 212 LEKSNLNHNEQLRKYLCKNEDETKNHYSKNTYNEQGNKLADLYK 255 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 17 TRCGLVHELRKHGFEENLMRNWVCLVEHESSRDTS 121 TR L H H + W+ +V ES DTS Sbjct: 248 TRLFLTHRKPFHPASTQSLSRWIKMVLAESGVDTS 282 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/10 (70%), Positives = 10/10 (100%) Frame = -2 Query: 487 GRCSNYIQIS 458 GRC++YIQ+S Sbjct: 67 GRCASYIQVS 76 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 5.0 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -2 Query: 289 VNFLSAFRCLSNVVSQEV 236 +NF++ FR ++N++ V Sbjct: 74 INFVATFRTIANIILMAV 91 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 179 RYWCSKGASPGK 214 R W +GA PGK Sbjct: 248 RGWIERGADPGK 259 >AM712905-1|CAN84644.1| 102|Tribolium castaneum hypothetical protein protein. Length = 102 Score = 21.0 bits (42), Expect = 6.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 326 NHCQGSLPDISSC*IP 373 NH QGS P+I S P Sbjct: 77 NHIQGSKPNILSSAFP 92 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,280 Number of Sequences: 336 Number of extensions: 1948 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -