BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D11f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33985.1 68417.m04822 expressed protein 29 2.5 At5g25960.1 68418.m03088 hypothetical protein various predicted ... 27 5.8 At4g28550.1 68417.m04084 RabGAP/TBC domain-containing protein si... 27 5.8 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 16 HEMRSRA*AEETWLRRKSHEELGMSGRAR 102 H A EE WLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At5g25960.1 68418.m03088 hypothetical protein various predicted proteins, Arabidopsis thaliana contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 352 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +2 Query: 44 RKHGFEENLMRNWVCLVEHESSRDTSKTNTNRNGSKDYGLFQINDRYWCSKGASP 208 ++H F+ +RN ++ T KT NGS + QI + W G P Sbjct: 55 KQHAFDHPALRNHKIQMKPSVDFGTKKTTIPNNGSSE----QITSQIWSKSGNCP 105 >At4g28550.1 68417.m04084 RabGAP/TBC domain-containing protein similar to SP|P09379 GTPase-activating protein GYP7 (Fragment) {Yarrowia lipolytica}; contains Pfam profile PF00566: TBC domain Length = 424 Score = 27.5 bits (58), Expect = 5.8 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 290 KRHRFDAWYGWKNHCQGSLPDISS 361 + HR + +Y WK C+ +P + S Sbjct: 100 RNHRREQYYAWKEECKNMVPLVGS 123 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,859,574 Number of Sequences: 28952 Number of extensions: 177372 Number of successful extensions: 489 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -