BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D09f (518 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0203 - 27487469-27489787 31 0.55 04_03_0139 + 11727207-11727359,11727534-11727674,11728607-11728804 29 2.2 >01_06_0203 - 27487469-27489787 Length = 772 Score = 31.1 bits (67), Expect = 0.55 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +3 Query: 303 LLTAPKSLAFPWNLPFLKAPFAFSISVIMSPSALQCSSGP*IMICPS 443 L KS AFP L +LK P++ ++ + SAL CS G + PS Sbjct: 383 LFNGYKSPAFPGTL-YLKVPYSTNLQASSTQSALTCSPGSQEIATPS 428 >04_03_0139 + 11727207-11727359,11727534-11727674,11728607-11728804 Length = 163 Score = 29.1 bits (62), Expect = 2.2 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = -3 Query: 153 VIDVLIQCIQRNFFLLVTNLXDKH 82 V+D+++ + RNFF L+ N+ +H Sbjct: 75 VVDLIVTVVNRNFFRLIHNIHGRH 98 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,659,883 Number of Sequences: 37544 Number of extensions: 204744 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -