BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D09f (518 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC019324-1|AAH19324.1| 525|Homo sapiens alanyl-tRNA synthetase ... 49 9e-06 BC004172-1|AAH04172.1| 525|Homo sapiens alanyl-tRNA synthetase ... 49 9e-06 CR456599-1|CAG30485.1| 423|Homo sapiens TTLL1 protein. 29 7.4 BC014968-1|AAH14968.1| 423|Homo sapiens tubulin tyrosine ligase... 29 7.4 AL589867-1|CAC34478.1| 394|Homo sapiens hypothetical protein pr... 29 7.4 AL096886-1|CAB51469.1| 423|Homo sapiens hypothetical protein pr... 29 7.4 AL096883-1|CAB51423.1| 385|Homo sapiens hypothetical protein pr... 29 7.4 AL022476-2|CAB39176.1| 423|Homo sapiens tubulin tyrosine ligase... 29 7.4 AF104927-1|AAG29879.1| 423|Homo sapiens tubulin-tyrosine ligase... 29 7.4 AF488550-1|AAO49470.1| 774|Homo sapiens hyperpolarization activ... 29 9.8 >BC019324-1|AAH19324.1| 525|Homo sapiens alanyl-tRNA synthetase domain containing 1 protein. Length = 525 Score = 49.2 bits (112), Expect = 9e-06 Identities = 22/61 (36%), Positives = 35/61 (57%) Frame = -2 Query: 454 DRAKEGQIIIQGPEEHCKALGDMITEMLKAKGAFKNGRFQGKASDLGAVNKCKKLVEDYF 275 D G ++ GP + LG + E+L+ KGA K GRFQGKA+ + + + L++DY Sbjct: 459 DEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYI 518 Query: 274 N 272 + Sbjct: 519 S 519 >BC004172-1|AAH04172.1| 525|Homo sapiens alanyl-tRNA synthetase domain containing 1 protein. Length = 525 Score = 49.2 bits (112), Expect = 9e-06 Identities = 22/61 (36%), Positives = 35/61 (57%) Frame = -2 Query: 454 DRAKEGQIIIQGPEEHCKALGDMITEMLKAKGAFKNGRFQGKASDLGAVNKCKKLVEDYF 275 D G ++ GP + LG + E+L+ KGA K GRFQGKA+ + + + L++DY Sbjct: 459 DEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYI 518 Query: 274 N 272 + Sbjct: 519 S 519 >CR456599-1|CAG30485.1| 423|Homo sapiens TTLL1 protein. Length = 423 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 FLRPCTVSYVPSTKQDLHMYIHI 73 F R CTV Y PST + +M++H+ Sbjct: 218 FCRFCTVKYTPSTSELDNMFVHL 240 >BC014968-1|AAH14968.1| 423|Homo sapiens tubulin tyrosine ligase-like family, member 1 protein. Length = 423 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 FLRPCTVSYVPSTKQDLHMYIHI 73 F R CTV Y PST + +M++H+ Sbjct: 218 FCRFCTVKYTPSTSELDNMFVHL 240 >AL589867-1|CAC34478.1| 394|Homo sapiens hypothetical protein protein. Length = 394 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 FLRPCTVSYVPSTKQDLHMYIHI 73 F R CTV Y PST + +M++H+ Sbjct: 218 FCRFCTVKYTPSTSELDNMFVHL 240 >AL096886-1|CAB51469.1| 423|Homo sapiens hypothetical protein protein. Length = 423 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 FLRPCTVSYVPSTKQDLHMYIHI 73 F R CTV Y PST + +M++H+ Sbjct: 218 FCRFCTVKYTPSTSELDNMFVHL 240 >AL096883-1|CAB51423.1| 385|Homo sapiens hypothetical protein protein. Length = 385 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 FLRPCTVSYVPSTKQDLHMYIHI 73 F R CTV Y PST + +M++H+ Sbjct: 180 FCRFCTVKYTPSTSELDNMFVHL 202 >AL022476-2|CAB39176.1| 423|Homo sapiens tubulin tyrosine ligase-like family, member 1 protein. Length = 423 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 FLRPCTVSYVPSTKQDLHMYIHI 73 F R CTV Y PST + +M++H+ Sbjct: 218 FCRFCTVKYTPSTSELDNMFVHL 240 >AF104927-1|AAG29879.1| 423|Homo sapiens tubulin-tyrosine ligase protein. Length = 423 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 5 FLRPCTVSYVPSTKQDLHMYIHI 73 F R CTV Y PST + +M++H+ Sbjct: 218 FCRFCTVKYTPSTSELDNMFVHL 240 >AF488550-1|AAO49470.1| 774|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel protein. Length = 774 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 360 APSRTADSKGKPVIWEP 310 APS A GKPV+WEP Sbjct: 589 APSTGAQRSGKPVLWEP 605 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,721,787 Number of Sequences: 237096 Number of extensions: 1132209 Number of successful extensions: 2321 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2321 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -