BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D07f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 4.4 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 5.8 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 5.8 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 4.4 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = +2 Query: 299 LLFSTLNCKSITTIDVYSFLWGYSDPLISQAYNIVPGIVYF 421 L+F L+ K+ Y YS ++ YN+ ++YF Sbjct: 183 LIFGKLDTKTSGKYKEYIIPANYSGWYLNHDYNLENKLIYF 223 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 366 YPHRKLYTSMVVMDL 322 YPH Y+S ++M+L Sbjct: 272 YPHVPEYSSSIIMEL 286 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 366 YPHRKLYTSMVVMDL 322 YPH Y+S ++M+L Sbjct: 287 YPHVPEYSSSIIMEL 301 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,858 Number of Sequences: 438 Number of extensions: 3390 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -