BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D07f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24225.1 68416.m03040 CLE19, putative CLAVATA3/ESR-Related 19... 28 4.4 At2g31270.1 68415.m03818 hydroxyproline-rich glycoprotein family... 27 7.7 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 27 7.7 >At3g24225.1 68416.m03040 CLE19, putative CLAVATA3/ESR-Related 19 (CLE19) Length = 74 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -3 Query: 351 LYTSMVVMDLQLRVENSSLNVFLMKNGKELTNEATLKRARLGTVTITSS 205 L +S++++ + E++S+ LM NG E LK +GT+ +S+ Sbjct: 9 LASSLLILAFIHQSESASMRSLLMNNGSYEEEEQVLKYDSMGTIANSSA 57 >At2g31270.1 68415.m03818 hydroxyproline-rich glycoprotein family protein Length = 571 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/47 (21%), Positives = 30/47 (63%), Gaps = 3/47 (6%) Frame = +2 Query: 101 IRQNIDIDLD---EEAGELEFTPNMKLRFVPEQSVARPEDVIVTVPN 232 +R+++ ++ D E+ ++FT ++ + VPE+ V+ ++++ +P+ Sbjct: 395 VRRSLSLNFDSYPEDERTMDFTDDIPIDQVPEEDVSSDDEILSILPD 441 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 294 NVFLMKNGKELTNEATLKRARLGTVTITSSGLATDCSGTKRSFMF 160 N+F+ K + N+ TL A G TI S +ATD G R + F Sbjct: 135 NLFVKNLDKSVDNK-TLHEAFSGCGTIVSCKVATDHMGQSRGYGF 178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,788,133 Number of Sequences: 28952 Number of extensions: 243592 Number of successful extensions: 605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 605 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -