BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D04f (504 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 21 5.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 5.5 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 21.4 bits (43), Expect = 5.5 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +2 Query: 2 VIKSILILPNF*QN*MFLILFSCK**SDVIQLHIFIQHTKI 124 V S+L++ + N LIL +C+ ++HI + H I Sbjct: 42 VFYSVLMIISAIGNTTVLILITCRKRVSKSRIHIMLMHLAI 82 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 347 TKGICLSGCLLECPEFPICFSANFRISLIALGARFLNPTP 228 T G+ G L C E +A ++ +G+R +P P Sbjct: 379 TPGLDSDGIRLPCREVEAAATARNVVAPFLIGSRRTSPPP 418 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,359 Number of Sequences: 438 Number of extensions: 2300 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -