BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D02f (517 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe... 26 3.8 SPAC56F8.13 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 8.9 >SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 25.8 bits (54), Expect = 3.8 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = -3 Query: 416 KCQNPSHYNKIHTQKSSNHVQIIASFFIINMIMIPTHRFSKPSLPQLLKTRIN 258 KC + Q+ S+ V +I F + ++ + T S+P L +L + N Sbjct: 151 KCPLSEQFINFINQQDSDKVVLIRGFLLPHLASLTTKNVSEPELDKLRHSLYN 203 >SPAC56F8.13 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 101 Score = 24.6 bits (51), Expect = 8.9 Identities = 10/47 (21%), Positives = 25/47 (53%) Frame = -3 Query: 422 QHKCQNPSHYNKIHTQKSSNHVQIIASFFIINMIMIPTHRFSKPSLP 282 + K +NP +N ++T+ H + + + ++ T++ + PS+P Sbjct: 10 EKKTKNPYSHNHVNTKLILPHNTFLTNILFLLGLIKHTNQLTFPSIP 56 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,936,638 Number of Sequences: 5004 Number of extensions: 37879 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 208287218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -