BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305D02f (517 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) 27 6.9 >SB_30776| Best HMM Match : HLH (HMM E-Value=1.7e-13) Length = 1217 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = -3 Query: 440 PSCTTTQHKCQNPSHYNKIHTQKSSNHVQIIASFFIINMIMIPTHRFSKPSLPQLLKTRI 261 P+C P H SS ++++F I N+I T + S P+ Q + T + Sbjct: 824 PTCAPNDGVSTRPRHAQLSSNNNSSQQDDVLSNFNISNLIPCITSQSSAPTQKQ-VATHL 882 Query: 260 N 258 N Sbjct: 883 N 883 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,417,067 Number of Sequences: 59808 Number of extensions: 250384 Number of successful extensions: 563 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -