BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305C07f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 29 0.033 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 5.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 5.0 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 21 8.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 28.7 bits (61), Expect = 0.033 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -3 Query: 402 LANILSLVALKLQHLAVLRVLHDRTVARELLLACPH 295 L +I VAL ++HLA RV+H AR +L+ H Sbjct: 594 LLSIARQVALGMEHLAKTRVVHRDLAARNVLVCENH 629 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 5.0 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -3 Query: 84 ILRTQQYILSLITRCYVLADK 22 I+RT L ++RC +L+++ Sbjct: 669 IIRTDHQALKFLSRCRLLSER 689 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 5.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 109 LFVSTKRCDTTHSTIYTVTDNALLCAR*QT 20 +F S CD +STI TV+ L + QT Sbjct: 291 IFDSIHLCDVCYSTIGTVSKAGELIHQIQT 320 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 109 LFVSTKRCDTTHSTIYTVT 53 +F S CD +STI TV+ Sbjct: 309 IFDSIHLCDVCYSTIGTVS 327 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,116 Number of Sequences: 336 Number of extensions: 2455 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -