BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305C05f (374 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 172 3e-45 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 3.7 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 5.0 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 22 6.5 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 6.5 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 22 8.7 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 22 8.7 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 172 bits (419), Expect = 3e-45 Identities = 81/112 (72%), Positives = 96/112 (85%) Frame = +1 Query: 1 FETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAFQKIQIRL 180 FET I QA++ELE NSDLK QLR+LYIT+A+E+E +NKK+IIIYVP+PK KAFQK+Q RL Sbjct: 18 FETQIGQAILELEMNSDLKPQLRDLYITRAREVEFNNKKAIIIYVPVPKQKAFQKVQTRL 77 Query: 181 VRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILE 336 VRELEKKFSGKHVVF+ +R+ILPKP R NKQKRPRS +T+VYDAILE Sbjct: 78 VRELEKKFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRSPNVTAVYDAILE 129 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 3.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 204 ELLFELTDKPDLDLLKGLQFRHRHIDDDR 118 ELLFE P LDLLK + +I D+ Sbjct: 96 ELLFEGVKDPLLDLLKTINSTSLNIPFDK 124 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 22.6 bits (46), Expect = 5.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 95 KLNYTIRSRSSSMCR 139 + N TIRSRSSS+ R Sbjct: 271 RTNSTIRSRSSSLSR 285 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 22.2 bits (45), Expect = 6.5 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 269 RVLWLGLGRILRSPTKTTCLPLNF 198 R LWL L ++ R +TC F Sbjct: 211 RSLWLRLSKLARDTGFSTCYTFTF 234 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.2 bits (45), Expect = 6.5 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 327 SIVHRGQCP*AWPLLFVSNTGFV 259 SIVHR + PLL V+ FV Sbjct: 1012 SIVHRQEIEDMLPLLLVATCAFV 1034 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 21.8 bits (44), Expect = 8.7 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 175 RLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQK 288 RLVRE+++KFS + D+ LP S + V N ++ Sbjct: 628 RLVREMKRKFS-----VIVDKVELPDESGEPVVENPKQ 660 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -3 Query: 90 SFCNVKLPKLGFEVGVGFEFDQRLRD 13 SFC ++ K +G+ FD+R D Sbjct: 631 SFCGLRDKKYPDRRAMGYPFDRRTAD 656 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 386,341 Number of Sequences: 2352 Number of extensions: 7070 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 28804305 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -