BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305C05f (374 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 25 0.22 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 2.7 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 6.3 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 20 8.3 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 20 8.3 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 20 8.3 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 20 8.3 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 20 8.3 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.4 bits (53), Expect = 0.22 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +1 Query: 7 TSISQALVELETNSDLKAQLRE 72 T++S AL EL N D++ +LRE Sbjct: 311 TTMSNALYELALNQDVQKKLRE 332 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 2.7 Identities = 16/78 (20%), Positives = 32/78 (41%) Frame = +1 Query: 100 ELHNKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVAN 279 EL KS + +P+P + + + +KK +G F + + + + Sbjct: 552 ELKRLKSTVSLLPLPLARTPSVMSASSTCKKDKKNAGSGSRFTIYKANKASKKKREKSSA 611 Query: 280 KQKRPRSRTLTSVYDAIL 333 K++R ++TL V L Sbjct: 612 KKERKATKTLAIVLGVFL 629 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 20.6 bits (41), Expect = 6.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 234 VSNKDYMFTTELLFELTD 181 +SN M TELL ELT+ Sbjct: 2 LSNNSSMTQTELLQELTN 19 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 20.2 bits (40), Expect = 8.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 176 LIWIF*KAFSLGIGT*MMIDFLLCSSISLAFVM 78 +IWIF + SL + M I L I +AF M Sbjct: 78 VIWIFSTSKSLRTPSNMFIVSLAIFDIIMAFEM 110 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 20.2 bits (40), Expect = 8.3 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = -1 Query: 143 GIGT*MMIDFLLCSSISLAFVM*SSRSWALRSELVSSS 30 G+ T +++ L+C SIS W L E + S Sbjct: 416 GLITGLIMRVLICGSISEEQKFDDEAHWELEEESLQGS 453 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.2 bits (40), Expect = 8.3 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -1 Query: 299 ERGLFCLLATRVLWLGLGRILRSPTKTTCLPLNF 198 E + L V +L +L +PT TC+ F Sbjct: 552 ELTIILLAGVLVCYLNTFLLLATPTTVTCILQRF 585 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 20.2 bits (40), Expect = 8.3 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 176 LIWIF*KAFSLGIGT*MMIDFLLCSSISLAFVM 78 +IWIF + SL + M I L I +AF M Sbjct: 78 VIWIFSTSKSLRTPSNMFIVSLAIFDIIMAFEM 110 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.2 bits (40), Expect = 8.3 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -1 Query: 299 ERGLFCLLATRVLWLGLGRILRSPTKTTCLPLNF 198 E + L V +L +L +PT TC+ F Sbjct: 642 ELTIILLAGVLVCYLNTFLLLATPTTVTCILQRF 675 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,785 Number of Sequences: 438 Number of extensions: 1893 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9052365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -