BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305C04f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.06 |sam50||SAM complex subunit Sam50 |Schizosaccharomyc... 27 1.7 SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosac... 25 9.0 >SPAC17C9.06 |sam50||SAM complex subunit Sam50 |Schizosaccharomyces pombe|chr 1|||Manual Length = 475 Score = 27.1 bits (57), Expect = 1.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 297 KSKQRTQETFSRVSKLKAENQVLEEKVNFIKTT 395 +SK +ETF +S++ AEN L ++ I+ T Sbjct: 20 ESKLSAEETFKSLSEILAENSTLPVGISSIRVT 52 >SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 385 SKQLQFLKDLFFAQAKKDTTELEGIDLNKLFE 480 SK+++ + + ++ KKD + + DLNK FE Sbjct: 534 SKKVEEKEPFYVSKDKKDISAVNLADLNKRFE 565 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,702,596 Number of Sequences: 5004 Number of extensions: 28025 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -