BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305C02f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antip... 25 6.8 SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosacchar... 25 9.0 >SPAC3A11.09 |sod22||plasma membrane alkali metal cation/H+ antiporter Sod22|Schizosaccharomyces pombe|chr 1|||Manual Length = 759 Score = 25.0 bits (52), Expect = 6.8 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 319 KGEPLTDDLVQQHAPRLRFL 378 +G P+ +D QH P +RFL Sbjct: 733 EGSPVEEDNEAQHRPNIRFL 752 >SPAC6C3.06c |||P-type ATPase, calcium transporting|Schizosaccharomyces pombe|chr 1|||Manual Length = 1033 Score = 24.6 bits (51), Expect = 9.0 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 275 LHHLRCNFQL*NR*KRENH*QTTWCNNTLPDSGFYLVLLH 394 +HH F L N+ + + T W N L G Y V+++ Sbjct: 253 VHHFYGTFTLNNQKRPISVDHTLWANTVLASDGVYGVVVY 292 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,001,230 Number of Sequences: 5004 Number of extensions: 36318 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -