BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305B10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 1.4 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 1.4 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 1.4 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 1.4 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.5 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 3.3 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 7.7 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 7.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.7 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 459 HFLFKIAHNGTLRHSSNRHHI 521 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 459 HFLFKIAHNGTLRHSSNRHHI 521 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 459 HFLFKIAHNGTLRHSSNRHHI 521 HF +I NGT+ + RH I Sbjct: 214 HFALRIYRNGTVNYLMRRHLI 234 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 1.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 459 HFLFKIAHNGTLRHSSNRHHI 521 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 84 PSGPASSNKTNFATSRCSS 140 P PASS+ ++ TS CSS Sbjct: 589 PDKPASSSASSAPTSVCSS 607 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 410 IGHNPDAKRTRVKLPSGAKKVL 345 IG+ + K+TR LP+G +KVL Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVL 77 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 150 GSLTYMLMVTTTVRMLYRVH 209 GS+TY + TTT+ + +H Sbjct: 147 GSVTYGMRFTTTLACMMDLH 166 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.0 bits (42), Expect = 7.7 Identities = 5/14 (35%), Positives = 10/14 (71%) Frame = -3 Query: 252 QGQT*LLAICTWCC 211 +G+ +++ C WCC Sbjct: 3 KGRHVVMSCCCWCC 16 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 7.7 Identities = 14/63 (22%), Positives = 24/63 (38%) Frame = -1 Query: 428 GNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYK 249 G +T + H P + P+ PSS+ G +P + G +K + Sbjct: 493 GAASTAVIHEPVVETNSSPSPNPRIASAPSSSTSSSPPAKGAAAAGQPSKRNGGETNKQE 552 Query: 248 VKR 240 +KR Sbjct: 553 LKR 555 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,908 Number of Sequences: 438 Number of extensions: 3642 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -