BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305B06f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 171 3e-43 SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.047 SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) 29 1.8 SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_44616| Best HMM Match : rve (HMM E-Value=0.012) 28 4.1 SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) 28 4.1 SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) 28 5.4 SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) 28 5.4 SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) 27 7.1 SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_52288| Best HMM Match : Coprinus_mating (HMM E-Value=0.86) 27 9.4 SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) 27 9.4 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 171 bits (416), Expect = 3e-43 Identities = 75/128 (58%), Positives = 100/128 (78%) Frame = +3 Query: 3 MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFG 182 MK I+A++ V IPD + V VKSR+VTV GPRG LKRNF+HL +++ V ++V+ WF Sbjct: 557 MKTILASETVTIPDNVEVKVKSRVVTVTGPRGTLKRNFRHLRLELTKVGKDKVRVDVWFA 616 Query: 183 SKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKY 362 S+KELA V+T+ +H+ENMIKGV G++YKMRAVYAHFPIN E +++E+RNFLGEKY Sbjct: 617 SRKELACVKTIITHIENMIKGVIYGYRYKMRAVYAHFPINIAIQENGTLVEVRNFLGEKY 676 Query: 363 IRRVKMAP 386 +RRV+M P Sbjct: 677 VRRVRMRP 684 >SB_40010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 34.7 bits (76), Expect = 0.047 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 471 ALIQQSTTVKNKDIRKF 521 ALIQQST VKNKDIRKF Sbjct: 2 ALIQQSTKVKNKDIRKF 18 >SB_46518| Best HMM Match : VWA (HMM E-Value=1.6e-07) Length = 309 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 Query: 442 LPSMINSSFCLGELTTVTPGAIFTLLMYFSPKKLRISIIE 323 +P I S LG+L +T G I T PKKL +IE Sbjct: 218 IPIAIGSKVNLGQLNILTAGPIITANTSGDPKKLANQVIE 257 >SB_7938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -2 Query: 217 QTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLLRTPRGPLTVT 74 QT++T A F D RRR F+ +S C + L R+P P++ T Sbjct: 85 QTMITTA--FPDTRKSPLTRRRNFSDGVSDLSCTENLARSPCAPVSPT 130 >SB_44616| Best HMM Match : rve (HMM E-Value=0.012) Length = 1189 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Frame = +3 Query: 33 KIPDGLTVHVKSRLVTVKGPRG---VLKRNFKHL-AVDIRMVNPRLLKV 167 K+ DGL VH+ ++ V K P+ + KR + L A+ I + +P + KV Sbjct: 4 KLDDGLRVHIVTQYVLFKNPKKLEIIAKRQKETLEALQINLDHPHVAKV 52 >SB_36341| Best HMM Match : DUF329 (HMM E-Value=1.7) Length = 197 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = -1 Query: 155 TRVYHANVNSQVFKVP-------FENSAGPFNCHQTRFHMDRKP 45 TR YH NV VF V F S G N HQ + DR+P Sbjct: 57 TRSYHENVVRPVFGVSDYWYRYEFAKSRGQINRHQLSWREDRQP 100 >SB_29064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = -2 Query: 472 AAELETSSKELPSMINSSFCLGELTTVTPGAIFTLLMYFSPKKLRISIIEL 320 AAE++TS L + + S CL VT IFT MY P+++ ++ L Sbjct: 234 AAEVKTSRIFLLVINSFSICLAPFMIVTFIEIFTGTMYTVPRQVYLATTNL 284 >SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) Length = 762 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Frame = +3 Query: 318 GNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQ--KDELIIEGNSLEDVSSSAALIQQST 491 G ++ +++ LG++ + T + K+EL +SLE+VS A +Q S Sbjct: 196 GREVVRLKDELGKQASNELSFIAKTTELEDQLVLLKEELNSRVSSLENVSKQLAELQSSA 255 Query: 492 TVKNKDI 512 K+++I Sbjct: 256 LTKDEEI 262 >SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30) Length = 1152 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 Query: 60 VKSRLVTVKGPRGVLKRNFKHL 125 V++R TV PRG L+RN +HL Sbjct: 1069 VETRSYTVSTPRGELRRNRRHL 1090 >SB_52819| Best HMM Match : E-MAP-115 (HMM E-Value=0.82) Length = 883 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 3 MKQIVANQKVKIPDGLTVHVKSRLVTVKGPRG 98 +K++ + K K DG+ VH K+ TV+ PRG Sbjct: 104 IKKLEEDLKKKTCDGVLVHRKAVAATVEEPRG 135 >SB_23757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2834 Score = 27.5 bits (58), Expect = 7.1 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 5/90 (5%) Frame = +3 Query: 186 KKELAAVRTVCSHVENMIKGVTKGFQY-KMRAVYAHFPI--NCVTTEGNSIIE-IRNFLG 353 K+ LAA + V + N+ KGVT+G K R V PI V T+G + + + G Sbjct: 948 KRALAAAKVVKTERVNVAKGVTQGMPVTKGRVVTQGMPITPGRVVTQGKVVTQGMPVTPG 1007 Query: 354 EKYIRRVKMAPGVTVVNS-PKQKDELIIEG 440 + + + PG V P + ++ +G Sbjct: 1008 RVVTQGIPVTPGRIVTQGIPVTQGRVVTQG 1037 >SB_52288| Best HMM Match : Coprinus_mating (HMM E-Value=0.86) Length = 769 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/56 (26%), Positives = 28/56 (50%) Frame = +3 Query: 249 TKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQ 416 T+G MR + P + VTTE ++++ +GE+ + P T++ +P Q Sbjct: 384 TRGDHVTMRGEHPTTPASSVTTEDKDLLQML-AVGEQGLANKGTVPQSTLITTPIQ 438 >SB_42363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 164 LQETRVYHANVNSQVFKVPFENSAGPFNCHQ 72 L TR+ + V+S +V E S P++CHQ Sbjct: 160 LYNTRIPNVTVSSDGGEVELEISDDPYDCHQ 190 >SB_2047| Best HMM Match : Ependymin (HMM E-Value=6e-05) Length = 739 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 6/43 (13%) Frame = -1 Query: 113 VPFENS-AGPFNCHQTRFHMD--RKPVW---DFDFLICYNLLH 3 +PF GP +C +TRF +D R P W D+ L+C +++ Sbjct: 6 IPFNALIVGPTSCGKTRFVVDRLRGPFWVKFDYILLVCPTIVY 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,439,887 Number of Sequences: 59808 Number of extensions: 343087 Number of successful extensions: 876 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 875 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -