BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305B03f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0024 + 159839-159923,160395-160442,160884-160895,161347-16... 27 9.1 >07_01_0024 + 159839-159923,160395-160442,160884-160895,161347-161427, 161530-161675,161918-161965,162054-162203,165647-165706, 165788-165859,165960-166409,166640-166839,167239-168236, 168676-168683,169057-169230,169341-169659,169748-169824, 169897-169966,170040-170111,170204-170418,170540-170665, 170751-171046,171133-171157,171163-171303,171400-171498, 171571-171702,171793-171912 Length = 1407 Score = 27.1 bits (57), Expect = 9.1 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +2 Query: 173 YYLSTDHRYRIRIQTKNC*HYNKLRHNNILSRLHSCDPTSMVLSMIL 313 Y LS HR+ + Q K HYN + + S+ HS D + S IL Sbjct: 1204 YVLSVRHRFPVSDQEKR--HYNAICKLSESSKWHSYDAVDIDNSKIL 1248 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,966,665 Number of Sequences: 37544 Number of extensions: 129628 Number of successful extensions: 174 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 173 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -