BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305B01f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) 38 0.004 SB_38168| Best HMM Match : Lectin_C (HMM E-Value=7.9e-06) 32 0.25 SB_51702| Best HMM Match : SURF6 (HMM E-Value=4) 32 0.33 SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.76 SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 31 0.76 SB_52925| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.0 SB_43175| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.0 SB_3592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.3 SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.8 SB_44860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_52567| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.3 SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.3 SB_10554| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.3 SB_48804| Best HMM Match : DUF21 (HMM E-Value=0.31) 29 3.1 SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.1 SB_11863| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.1 SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.1 SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.1 SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.1 SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) 28 4.1 SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_40389| Best HMM Match : DUF590 (HMM E-Value=0) 28 5.4 SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.4 SB_28976| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.4 SB_14469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_28163| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_19065| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.4 SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.4 SB_17356| Best HMM Match : DUF590 (HMM E-Value=0) 28 5.4 SB_8254| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.4 SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) 27 7.1 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_14898| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.1 SB_1571| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-16) 27 7.1 SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.1 SB_29933| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.1 SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 8.0 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) 27 9.4 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 27 9.4 SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 9.4 >SB_41240| Best HMM Match : UCH (HMM E-Value=9.2e-25) Length = 1088 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +3 Query: 81 IQTLIEMGFPKERAEKALAVTNYKGVEPAMEWLLAHAEDLAVSSEPSNSQAG 236 + +I MGF +++A KAL T+ +E A +W+ +HA +L N + G Sbjct: 899 VSMIISMGFTRDQAIKALKATD-NNLERAADWIFSHAHELDAMDVDMNEETG 949 >SB_38168| Best HMM Match : Lectin_C (HMM E-Value=7.9e-06) Length = 583 Score = 32.3 bits (70), Expect = 0.25 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = +3 Query: 102 GFPKERAEKALAVTNYKGVEPAMEWLLAHAEDLAVSSEPSNSQAGES 242 G+ + +EKAL T GV+PAM+W+ + D+A+ + +NS A E+ Sbjct: 316 GYDRCISEKALIATKNTGVQPAMDWISMN-PDVALGN-ATNSSAIET 360 >SB_51702| Best HMM Match : SURF6 (HMM E-Value=4) Length = 260 Score = 31.9 bits (69), Expect = 0.33 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 210 RILRGPRREPKATPWQALHPYNWSRLKL 127 R+ RG RR P P LHP W++ L Sbjct: 47 RVTRGRRRRPNRVPDHVLHPEKWTKYSL 74 >SB_3590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 31.5 bits (68), Expect = 0.44 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F E++ H Sbjct: 188 KPYKCDECGKCFNQSGEVKIH 208 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F E++ H Sbjct: 356 KPYKCDECGKCFIQSGEVKIH 376 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 76 KPYKCDECGKCFTRKTTLKRH 96 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 132 KPYKCDECGKCFTRKTTLKRH 152 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 272 KPYKCDECGKCFNQSANLKTH 292 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 412 KPYKCDECGKCFTRKTTLKTH 432 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 328 KPYKCDECGKCFIQNADLNIH 348 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K +CDECGK F + ++ H Sbjct: 244 KPYECDECGKCFTRKTHLKAH 264 >SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTNHS 395 K+ KCD+C K + + D +E H +HS Sbjct: 360 KNYKCDDCNKRYFSYDALEAHKQTESHS 387 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KC+ECGK F +D+++ H Sbjct: 443 KKHKCEECGKAFARKDKLKRH 463 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTNHSSF 401 K KC ECGK F +D + H KT+ F Sbjct: 507 KPYKCQECGKGFARRDNMNDH-IKTHTKEF 535 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 324 CDECGKLFKNQDEIEYHAAKTNH 392 CDECGK+F +Q ++ H KT H Sbjct: 390 CDECGKVFHSQIYLKRH--KTVH 410 >SB_26192| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 777 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 KS KCDECGK F ++ H Sbjct: 521 KSYKCDECGKCFSESGNLKKH 541 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K+ KCDECGK F + ++ H Sbjct: 467 KTYKCDECGKCFNRKTNLKRH 487 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 633 KPYKCDECGKCFTQLTHVKRH 653 >SB_17592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3592 Score = 30.7 bits (66), Expect = 0.76 Identities = 17/41 (41%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +3 Query: 81 IQTLIEMGFPKERAEKALAVTNYK---GVEPAMEWLLAHAE 194 +Q LIEMGFP++ E AL + E + WLL H E Sbjct: 843 VQQLIEMGFPRQHVEYALKELREEEDPRPELVVAWLLDHPE 883 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/31 (35%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAK-TNHSSF 401 + +C ECG+LF +D++ H K N+ +F Sbjct: 340 REFRCKECGELFPKEDKLNAHVLKHPNYKAF 370 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHA 377 K KC+ C K FK +D + H+ Sbjct: 483 KRFKCEVCDKSFKREDHLRVHS 504 >SB_52925| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 393 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F Q ++ H Sbjct: 170 KPFKCDECGKCFNQQGYLKKH 190 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + +++H Sbjct: 198 KPHKCDECGKYFTHYGNLKFH 218 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F++ ++ H Sbjct: 114 KPHKCDECGKCFRHSGALKIH 134 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F D ++ H Sbjct: 254 KPHKCDECGKCFCRPDNLKEH 274 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F+ ++ H Sbjct: 366 KPHKCDECGKCFRLSGNLKKH 386 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + H Sbjct: 282 KPHKCDECGKCFTQSKSLRRH 302 >SB_43175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 30.3 bits (65), Expect = 1.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 113 KPFKCDECGKCFNQSENLKTH 133 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 KS KCDECGK F ++ H Sbjct: 281 KSYKCDECGKCFTRHTHLKRH 301 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHA-AKTNHSSF 401 K KCDECGK F + H T H F Sbjct: 85 KPHKCDECGKCFTESRFLNKHVRIHTGHKPF 115 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECG+ F ++ H Sbjct: 141 KPYKCDECGRCFNRSGHLKTH 161 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K+ KCDECG+ F ++ H Sbjct: 197 KTYKCDECGECFNQSRNLKTH 217 >SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 927 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 KS KCDECGK F ++ H Sbjct: 73 KSYKCDECGKFFTQHAHLKRH 93 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F Q ++ H Sbjct: 213 KPYKCDECGKCFTQQTHLKTH 233 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 241 KPYKCDECGKCFSESGNLKKH 261 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K CDECGK F Q ++ H Sbjct: 101 KPYNCDECGKCFTQQTHLKTH 121 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 185 KPYKCDECGKCFTRKANLKTH 205 >SB_3592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 30.3 bits (65), Expect = 1.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHA 377 K KCDECGK F ++ HA Sbjct: 268 KPYKCDECGKCFNQSGSLKTHA 289 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + H Sbjct: 156 KPYKCDECGKCFNQSGALNSH 176 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + H Sbjct: 184 KPYKCDECGKCFNQSGALNSH 204 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 240 KPHKCDECGKCFNQSGNLKKH 260 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHA 377 K KC+ECG+LF+ ++ H+ Sbjct: 802 KKFKCEECGRLFRRLHQLNVHS 823 >SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 336 Score = 29.9 bits (64), Expect = 1.3 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYHAAKTNHS 395 +CD+CGK+FK + + H +H+ Sbjct: 167 RCDQCGKIFKTKYTLSIHLKMPDHT 191 >SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHA 377 K+ KCDECGK F + + HA Sbjct: 26 KAYKCDECGKCFTRRAYLRAHA 47 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 222 KPYKCDECGKCFNQSGNLKTH 242 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 282 KPYKCDECGKCFNQSGTLKTH 302 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 366 KPYKCDECGKCFTRSGSLKTH 386 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F+ + H Sbjct: 138 KPYKCDECGKCFRQSGVLTTH 158 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 310 KPYKCDECGKCFTVKSNLKTH 330 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTNHSS 398 K L+CD C K+F+ ++++ H +T H S Sbjct: 710 KPLRCDRCSKVFETIEQLQEH--RTTHRS 736 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 324 CDECGKLFKNQDEIEYHAAKTNHSSF 401 CDECGK++K + HA N F Sbjct: 329 CDECGKVYKTAKLLRTHAKIHNKQRF 354 >SB_44860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.5 bits (63), Expect = 1.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK FK ++ H Sbjct: 163 KPYKCDECGKCFKQFASLKIH 183 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F+ ++ H Sbjct: 247 KPYKCDECGKSFRRSGHLKTH 267 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 79 KPYKCDECGKCFGRSGTLKIH 99 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F +++ H Sbjct: 107 KPHKCDECGKCFTRSGDLKGH 127 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 359 KPHKCDECGKCFSQSGHLKRH 379 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 51 KPHKCDECGKNFGRSEHLKKH 71 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 135 KPHKCDECGKCFGRSGNLKTH 155 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 29.5 bits (63), Expect = 1.8 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYHAAKTN 389 +CD+CG+ FK + +++H T+ Sbjct: 147 ECDQCGRCFKKNETLDHHHQNTH 169 >SB_52567| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 370 Score = 29.1 bits (62), Expect = 2.3 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTNHS 395 ++ +CD+CGK+FK + + H +H+ Sbjct: 200 ETYQCDQCGKVFKTKYTLTIHLKMPSHT 227 >SB_49489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K +CDECGK F D + H Sbjct: 400 KRFQCDECGKRFMRSDHLRKH 420 >SB_34889| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 615 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K+ KC ECG F QD ++ H Sbjct: 493 KNYKCPECGSAFTRQDNLKAH 513 >SB_10554| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 194 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F Q + + H Sbjct: 129 KPYKCDECGKCFTRQTDQKTH 149 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 101 KPYKCDECGKCFNQSANLKTH 121 >SB_48804| Best HMM Match : DUF21 (HMM E-Value=0.31) Length = 438 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 162 ALHPYNWSRLKLFLLVLWENPSRSMS 85 A P+NW+ L FL+ LW P R ++ Sbjct: 179 AKQPHNWTSLVRFLMELWLTPVRVLA 204 >SB_45205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 329 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F +++ H Sbjct: 132 KPYKCDECGKCFTRHAQLKAH 152 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 104 KPYKCDECGKCFTQHAHLKAH 124 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECG F +++ H Sbjct: 272 KPYKCDECGNCFSESGQLKVH 292 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECG+ F +++ H Sbjct: 188 KPYKCDECGECFSESGKLKRH 208 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 48 KPHKCDECGKCFTQSGTLKTH 68 >SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 426 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHA 377 K+ KCDECGK F + HA Sbjct: 61 KAYKCDECGKCFTRPAYLRAHA 82 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 257 KPYKCDECGKCFNQSGNLKTH 277 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 317 KPYKCDECGKCFNQSGTLKTH 337 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 401 KPYKCDECGKCFTRSGSLKTH 421 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F+ + H Sbjct: 173 KPYKCDECGKCFRQSGVLTTH 193 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 345 KPYKCDECGKCFTVKSNLKTH 365 >SB_11863| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 921 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 318 LKCDECGKLFKNQDEIEYHAAKTN 389 + CD+CGKLFK++ ++ H T+ Sbjct: 460 VSCDKCGKLFKDKRFLDVHLLCTH 483 >SB_45201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F +++ H Sbjct: 132 KPYKCDECGKCFTRHAQLKAH 152 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 412 KPYKCDECGKCFSESGNLKKH 432 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 104 KPYKCDECGKCFTQHAHLKAH 124 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECG+ F +++ H Sbjct: 188 KPYKCDECGECFSESGKLKRH 208 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 48 KPHKCDECGKCFTQSGTLKTH 68 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECG F +++ H Sbjct: 272 KPYKCDECGNCFSESGKLKRH 292 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K +CDECGK FK ++ H Sbjct: 392 KPYECDECGKCFKQSRTLKAH 412 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 504 KPYKCDECGKCFNQSGTLKSH 524 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + ++ H Sbjct: 532 KPYKCDECGKCFTVKSNLKTH 552 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 336 KPHKCDECGKCFAQSGTLKRH 356 >SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 365 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 KS +C ECGK FK + H Sbjct: 251 KSFECKECGKAFKRSSTLSTH 271 >SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 366 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 200 KPYKCDECGKCFNQSANLKTH 220 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F +++ H Sbjct: 228 KPYKCDECGKCFIQYVDLKRH 248 >SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) Length = 389 Score = 28.3 bits (60), Expect = 4.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTNH 392 K C+ CG+ +KN ++YH NH Sbjct: 199 KPYVCEICGRRYKNGPGLKYHYTHYNH 225 >SB_12745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +3 Query: 324 CDECGKLFKNQDEIEYHAAKTNHSSF 401 CDECGK++K + HA N F Sbjct: 261 CDECGKVYKTAKLLRTHAKIHNKQRF 286 >SB_40389| Best HMM Match : DUF590 (HMM E-Value=0) Length = 320 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -3 Query: 519 QPFLSLLFPYAFVSFSLLGAPVAPSFPLQLMVFFLQ*TLRNYCDSFLRRGT 367 Q +L ++ Y F++ + P+AP F L VF ++ + + LRR T Sbjct: 188 QEYLEMVIQYGFITLFVAAFPLAPFFALANNVFEIRIDADKFVND-LRRST 237 >SB_37452| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 211 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYHA 377 KC++CGKLF ++ HA Sbjct: 61 KCNQCGKLFTQSGDLRKHA 79 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTN 389 KS +C+ECGK F ++ H N Sbjct: 144 KSFQCEECGKRFTRAYNLKIHGRTHN 169 >SB_28976| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 277 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYHA 377 KC++CGKLF ++ HA Sbjct: 147 KCNQCGKLFTQSGDLRKHA 165 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTN 389 KS +C+ECGK F ++ H N Sbjct: 230 KSFQCEECGKRFTRAYNLKIHGRTHN 255 >SB_14469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 195 KPHKCDECGKCFAQSSSLKTH 215 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 223 KPHKCDECGKCFARSSSLKTH 243 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F +++ H Sbjct: 83 KPYKCDECGKCFAKSLKLKKH 103 >SB_28163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCD+CG+ FK + YH Sbjct: 17 KPHKCDKCGRGFKQLTHLTYH 37 >SB_19065| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 531 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAK 383 K KCDEC K F+ E++ H + Sbjct: 134 KPFKCDECEKTFRTALELQAHMGR 157 >SB_18526| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 322 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F ++ H Sbjct: 178 KPYKCDECGKCFTQLTHVKRH 198 >SB_17356| Best HMM Match : DUF590 (HMM E-Value=0) Length = 982 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/51 (29%), Positives = 26/51 (50%) Frame = -3 Query: 519 QPFLSLLFPYAFVSFSLLGAPVAPSFPLQLMVFFLQ*TLRNYCDSFLRRGT 367 Q +L ++ Y F++ + P+AP F L VF ++ + + LRR T Sbjct: 126 QEYLEMVIQYGFITLFVAAFPLAPFFALANNVFEIRIDADKFVND-LRRST 175 >SB_8254| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 684 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYHAA 380 +C ECGKLF +++ HAA Sbjct: 339 ECAECGKLFSYPSDLKRHAA 358 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTNHS 395 K +C++CG FK + H AKT HS Sbjct: 145 KPYECEQCGHCFKQMFSLLQH-AKTYHS 171 >SB_50714| Best HMM Match : TPR_2 (HMM E-Value=2.9e-15) Length = 458 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +3 Query: 81 IQTLIEMGFPKERAEKALAVTNYKGVEPAMEWLLA-HAEDLAVSSEPSNSQAG 236 +Q L +MGFP ++E A+ +Y V+ +E LLA + V S N+ +G Sbjct: 382 VQQLEDMGFPTNQSE--AAIQSYGTVQAGLEALLAGKGPNCVVQSMGMNAISG 432 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 27.5 bits (58), Expect = 7.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYH 374 +C ECGK ++ + E+ YH Sbjct: 214 QCQECGKSYRLRSELNYH 231 >SB_15879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K +CD+CGK F +I H Sbjct: 235 KPFECDKCGKTFSRSSDISKH 255 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCDECGK F + + H Sbjct: 179 KPYKCDECGKSFAFSNSLSRH 199 >SB_14898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +3 Query: 114 ERAEKALAVTNYKGVEPAMEWLLAHAEDLAVSSEPSNSQAGESSAPV 254 +R EK + ++N K E ++A AE +SSE S ESSA V Sbjct: 230 KRGEKDVPISNVKVAE-----VVAKAEKFGLSSEKLESDPNESSASV 271 >SB_6551| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 330 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 318 LKCDECGKLFKNQDEIEYHAAKTNHS 395 LKC +CGK FK + + H +H+ Sbjct: 161 LKCKQCGKNFKTKYTLAIHMKMPSHT 186 >SB_1571| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-16) Length = 265 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 315 SLKCDECGKLFKNQDEIEYHAAKTNHS 395 S++CD CG++F + ++ H K HS Sbjct: 109 SIRCDVCGRVFPREKSLQAH--KRTHS 133 >SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K+ KC+ CGK FK + H Sbjct: 306 KAFKCEVCGKCFKRDSHLHTH 326 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYHAAKTNH 392 KC +CG F+++D++ H K NH Sbjct: 1009 KCQDCGYYFQSEDDVLNH-IKRNH 1031 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 324 CDECGKLFKNQDEIEYHAAKTNH 392 CD CGK FKN + + H +H Sbjct: 1271 CDLCGKEFKNAEYMTKHIRMVHH 1293 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Frame = +3 Query: 321 KCDECGKLFKNQDE-----IEYHAAKTNH 392 KCD CGK F + ++YH A+T H Sbjct: 1904 KCDLCGKRFSRPETASKHILQYHEARTPH 1932 >SB_29933| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 420 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KCD+CGK F + ++ H Sbjct: 61 KPYKCDKCGKCFTRKSHLKTH 81 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K +CDECGK F ++ H Sbjct: 89 KPYECDECGKCFSESGNLKRH 109 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K +CDECGK F ++ H Sbjct: 145 KPYECDECGKCFSESGNLKRH 165 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K +CDECGK F ++ H Sbjct: 173 KPYECDECGKCFSESGNLKRH 193 >SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 25.0 bits (52), Expect(2) = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 312 KSLKCDECGKLF 347 K KCDECGK F Sbjct: 111 KYFKCDECGKSF 122 Score = 20.6 bits (41), Expect(2) = 8.0 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = +3 Query: 324 CDECGKLFKNQDEIEYH 374 CD CG F+ + + H Sbjct: 144 CDICGAYFRTSNALRCH 160 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAK 383 K KC ECG+ F Q ++ H K Sbjct: 590 KPYKCQECGQEFARQSQLNDHRLK 613 >SB_6589| Best HMM Match : zf-C2H2 (HMM E-Value=1.2e-36) Length = 651 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYH 374 K KC +CG+ FK ++YH Sbjct: 551 KPHKCKKCGRAFKQLTHLKYH 571 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 312 KSLKCDECGKLFKNQDEIEYHAAKTNHS 395 K KCD C K +K D + H K +HS Sbjct: 1290 KPYKCDMCDKSYKRPDALRVH--KISHS 1315 >SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 487 Score = 27.1 bits (57), Expect = 9.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 321 KCDECGKLFKNQDEIEYHA 377 KC+ECGK F ++++ H+ Sbjct: 432 KCEECGKTFTQTNDLKRHS 450 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,061,324 Number of Sequences: 59808 Number of extensions: 208786 Number of successful extensions: 1068 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1067 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -