BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305A05f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 86 1e-17 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_34777| Best HMM Match : VWA (HMM E-Value=0) 30 1.0 SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) 28 5.4 SB_40998| Best HMM Match : Ion_trans_2 (HMM E-Value=2.2e-15) 27 7.1 SB_6697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 27 9.4 SB_58298| Best HMM Match : Vicilin_N (HMM E-Value=0.48) 27 9.4 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 86.2 bits (204), Expect = 1e-17 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 1/119 (0%) Frame = -1 Query: 368 PFAFNSCPLRRIPQRYVIGTSTRISLGNFKLPKH-FNDDYFXXXXXXXXXXXXXKEGDDI 192 PF N PLRRIPQ YVI TST I + + KLP+H F D+ + K +D+ Sbjct: 2 PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEHAFADESY-----FKGEPKKKKRSEDM 56 Query: 191 FATKKEKYVPSEQRKTDQKTVDEAVIKAIGARPDKKVLRGYLKAAFGLRSSQYPHRLRF 15 F E+ PSEQR DQK VD+ ++ I A P+ ++ YL + F LR Q+PH + F Sbjct: 57 FEEAAEEKKPSEQRIADQKAVDDQILPKISAVPN---MKKYLSSLFSLRKGQFPHDMVF 112 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 30.3 bits (65), Expect = 1.0 Identities = 22/77 (28%), Positives = 35/77 (45%) Frame = -2 Query: 274 QNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSSAKPIRRQSTRL*SKPSEPD 95 + T ++ T++ + S+ +R S R H KP R++T SKP+EPD Sbjct: 966 RQTPLVDTTKAVGPLSSTSETRRRQSDSDSVLSRRLDH---TKPPLRKTTSNDSKPTEPD 1022 Query: 94 PTRRCSADTSKRPSDSA 44 +RR S S +A Sbjct: 1023 SSRRTYRAASMDASTTA 1039 >SB_34777| Best HMM Match : VWA (HMM E-Value=0) Length = 1268 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -3 Query: 174 EIRSI*AAQNRSEDSRRGCDQSHRSPTRQEGAPRIPQSGLRTPL 43 E++ Q + + +G ++ H QEG ++PQ G +TP+ Sbjct: 657 EVQGQEQGQGQDQSHVQGQEEGHSQDQGQEGTNQVPQQGEKTPI 700 >SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) Length = 1692 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 102 SPTRQEGAPRIPQSGLRTPLEPISPSAALL 13 SPT + G P +P S T P+ P +++L Sbjct: 299 SPTTENGTPDVPHSSFPTTGIPVIPQSSVL 328 >SB_40998| Best HMM Match : Ion_trans_2 (HMM E-Value=2.2e-15) Length = 355 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 139 RRQSTRL*SKPSEPDPTRRCSADTSKRPSDSAR 41 R ++T L + +PD CS+ SK+PSD R Sbjct: 177 RNRTTDLGAPVQKPDAISGCSSTLSKKPSDFDR 209 >SB_6697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 595 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 139 RRQSTRL*SKPSEPDPTRRCSADTSKRPSDSAR 41 R ++T L + +PD CS+ SK+PSD R Sbjct: 340 RNRTTDLGAPVQKPDAISGCSSTLSKKPSDFDR 372 >SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 407 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -1 Query: 173 KYVPSEQRKTDQKTVDEAVIKAIGARPDKKVLRGYLK 63 + VP E+ + + K ++E VIK I A+ + V R L+ Sbjct: 303 RLVPKERLEREPKVMEEPVIKEIAAKHNCSVARVLLR 339 >SB_58298| Best HMM Match : Vicilin_N (HMM E-Value=0.48) Length = 204 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 1/90 (1%) Frame = -2 Query: 289 ATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSSAKPIRRQSTRL*SK 110 AT+NC+ + + + +A +N +R LP+ +R T + RR + +L Sbjct: 118 ATNNCRRRNEQLPKAQRTTAEGATNNCRRRNEQLPKAQRTTAE-GTTNNCRRHNEQL--- 173 Query: 109 PSEPDPTRRCSADTSKRPSDS-ARANIPIG 23 P T + + +R ++ +A +P G Sbjct: 174 PKAQRTTAEGTTNNCRRHNEQLPKAYLPSG 203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,847,505 Number of Sequences: 59808 Number of extensions: 339902 Number of successful extensions: 1151 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1076 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1148 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -