BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305A02f (436 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 2.2 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 20 8.9 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 20 8.9 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.2 bits (45), Expect = 2.2 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 98 VYNMLMDLTDELELSDSGMESLT-TSKDDT 184 +Y+ L+DLTD EL G + + T DT Sbjct: 352 IYSDLLDLTDNNELFHLGSDEVNLTCWQDT 381 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 20.2 bits (40), Expect = 8.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 367 NKYMVWYQRPVWS 405 N M+ Y RP WS Sbjct: 38 NSQMIDYSRPNWS 50 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 20.2 bits (40), Expect = 8.9 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 367 NKYMVWYQRPVWS 405 N M+ Y RP WS Sbjct: 58 NSQMIDYSRPNWS 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,099 Number of Sequences: 336 Number of extensions: 2135 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9670396 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -