BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS305A02f (436 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0110 - 13539059-13539751,13539857-13540383,13541925-135424... 27 6.6 11_02_0047 + 7716315-7716420,7716518-7716647,7716785-7716856,771... 27 6.6 >11_04_0110 - 13539059-13539751,13539857-13540383,13541925-13542437, 13542606-13542786 Length = 637 Score = 27.1 bits (57), Expect = 6.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 116 DLTDELELSDSGMESLTTSKDDTP 187 DL DEL DSG+ S +S DTP Sbjct: 90 DLIDELCRRDSGLLSAASSSGDTP 113 >11_02_0047 + 7716315-7716420,7716518-7716647,7716785-7716856, 7717007-7717078,7717274-7717345,7717684-7717845, 7718105-7718176,7718435-7718503,7718788-7718859, 7718992-7719129,7719386-7719888,7720007-7720171, 7720267-7720403,7720488-7720707,7720793-7721028, 7721165-7721632 Length = 897 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 364 NCVCAIPYTLWEHFGQTPQSFRKSFIWFIVVL 269 NC CA+PY HF ++P F S F V+L Sbjct: 374 NCTCAVPYMGTLHF-RSPPFFDLSNDTFFVLL 404 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,863,101 Number of Sequences: 37544 Number of extensions: 199415 Number of successful extensions: 393 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 826450812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -