BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H12f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8F5M8 Cluster: FemAB family protein; n=9; Leptospira i... 36 0.74 UniRef50_A0YW39 Cluster: Putative uncharacterized protein; n=1; ... 32 9.2 UniRef50_Q4UJ34 Cluster: Putative uncharacterized protein; n=1; ... 32 9.2 UniRef50_A0CG75 Cluster: Chromosome undetermined scaffold_179, w... 32 9.2 >UniRef50_Q8F5M8 Cluster: FemAB family protein; n=9; Leptospira interrogans|Rep: FemAB family protein - Leptospira interrogans Length = 709 Score = 35.5 bits (78), Expect = 0.74 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = +1 Query: 328 MQYYITKLISYRKLFVVFFSKNIDQRNIEKIWSKSS*NVTL 450 + + L S++ LF + KNIDQ++I KIW S+ +++L Sbjct: 5 LMHLFAPLPSWKNLFSILSFKNIDQKSISKIWLTSTSDISL 45 >UniRef50_A0YW39 Cluster: Putative uncharacterized protein; n=1; Lyngbya sp. PCC 8106|Rep: Putative uncharacterized protein - Lyngbya sp. PCC 8106 Length = 198 Score = 31.9 bits (69), Expect = 9.2 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 397 DQRNIEKIWSKSS*NVTLCQKYIFVIIFRRLRVK-ASSHPC 516 D NIEK+WS VT K +II+ RL++K +SSH C Sbjct: 129 DFSNIEKVWSFKESKVTPLLK---IIIYERLQLKGSSSHGC 166 >UniRef50_Q4UJ34 Cluster: Putative uncharacterized protein; n=1; Theileria annulata|Rep: Putative uncharacterized protein - Theileria annulata Length = 1179 Score = 31.9 bits (69), Expect = 9.2 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -2 Query: 436 MNFCSKFFRYFVDRCFSKKKP 374 +N+C+K F+YF ++CF K P Sbjct: 212 INYCNKCFKYFCNQCFIKHSP 232 >UniRef50_A0CG75 Cluster: Chromosome undetermined scaffold_179, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_179, whole genome shotgun sequence - Paramecium tetraurelia Length = 236 Score = 31.9 bits (69), Expect = 9.2 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 369 ICGFFFEKHRSTKYRKNLEQKFIKCNFMS 455 +CG FE R K +KN+EQ+ I+ N S Sbjct: 67 VCGVIFEVSRRKKLKKNIEQRLIQENMYS 95 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 428,303,300 Number of Sequences: 1657284 Number of extensions: 7059981 Number of successful extensions: 15345 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14923 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15342 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -