BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H12f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16A10.04 |rho4||Rho family GTPase Rho4|Schizosaccharomyces p... 29 0.32 SPAC328.10c |rps502|rps5-2|40S ribosomal protein S5|Schizosaccha... 25 5.2 SPAC8C9.08 |rps5||40S ribosomal protein S5|Schizosaccharomyces p... 25 5.2 SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1... 25 9.0 SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomy... 25 9.0 SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 25 9.0 >SPAC16A10.04 |rho4||Rho family GTPase Rho4|Schizosaccharomyces pombe|chr 1|||Manual Length = 203 Score = 29.5 bits (63), Expect = 0.32 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 3/58 (5%) Frame = -3 Query: 432 TFAPN--FFDISLIDVFRKKNHK*F-PIAY*FSNIILHCFNLGCVITSSNCIVRRQPQ 268 T+ PN +++L D ++ + P++Y SN+IL CF++ C + +N + P+ Sbjct: 56 TYGPNSKVIELALWDTAGQEEYDRLRPLSYPNSNVILLCFSIDCPASLNNVTEKWYPE 113 >SPAC328.10c |rps502|rps5-2|40S ribosomal protein S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 203 Score = 25.4 bits (53), Expect = 5.2 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 285 VRRQPQDVR-LRRVQQDIASATVGS 214 VRRQ DV LRRV Q +A T+G+ Sbjct: 133 VRRQAVDVSPLRRVNQALALITIGA 157 >SPAC8C9.08 |rps5||40S ribosomal protein S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 203 Score = 25.4 bits (53), Expect = 5.2 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 285 VRRQPQDVR-LRRVQQDIASATVGS 214 VRRQ DV LRRV Q +A T+G+ Sbjct: 133 VRRQAVDVSPLRRVNQALALITIGA 157 >SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1|Schizosaccharomyces pombe|chr 2|||Manual Length = 775 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 375 GFFFEKHRSTKYRKNLEQKFIKCNFMSKIYFCNY 476 GFF++ S LEQ C M ++YF ++ Sbjct: 350 GFFWDSIDSKIRTMCLEQSLSACAIMKRVYFRHF 383 >SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomyces pombe|chr 3|||Manual Length = 384 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 270 QDVRLRRVQQDIASATVGSTSYNNYATP 187 +D+R I S ST+ N+Y+TP Sbjct: 292 RDIRSHSTNTTITSVDSASTALNSYSTP 319 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 451 IKLHFMNFCSKFFRYFVDRCFSKKKP 374 IKLH+ + Y ++CF +KP Sbjct: 764 IKLHYDHLSQALHEYEREKCFDVRKP 789 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,895,162 Number of Sequences: 5004 Number of extensions: 33307 Number of successful extensions: 82 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -