BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H10f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_17184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 27.9 bits (59), Expect = 5.4 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +2 Query: 341 RTHKRSYHQYYKHSVTKSL-LNYSCIILRPQEQLYRNTLK-DLER-LQRSHDTLAER 502 R++KRSY + YK S +S +Y R E+ Y+ + K ER +RS++ ER Sbjct: 203 RSYKRSYKRSYKRSYKRSYKRSYKRSYERSYERSYKRSYKRSYERSYERSYERSYER 259 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 329 YLPARTHKRSYHQYYKHSVTKSLLNYSCIILRPQEQLYRN-TLKDLERLQRSHDTLAER 502 +LP R + H S+T+ + + +I Q+ L N TLK + +LQ+ H L E+ Sbjct: 688 HLPVRDTQAPSHHPTHPSLTRRASDGNAVIPVMQQTLKENSTLKRIRQLQQEHLKLQEQ 746 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,052,642 Number of Sequences: 59808 Number of extensions: 317451 Number of successful extensions: 692 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -