BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H09f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 2.2 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 2.2 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 355 SIFMRFKLNAYLSYFEYLYLI*T*FKSNMSG 263 S RF + SYF YL I T + +SG Sbjct: 74 SFMSRFLCLPFYSYFFYLSYIYTTYSRKLSG 104 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 355 SIFMRFKLNAYLSYFEYLYLI*T*FKSNMSG 263 S RF + SYF YL I T + +SG Sbjct: 30 SFMSRFLCLPFYSYFFYLSYIYTTYSRKLSG 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,609 Number of Sequences: 336 Number of extensions: 2266 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -