BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H07f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 2.2 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 23 2.2 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 6.6 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 21 8.7 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 214 LDKLKAERERGITIDIALWKFETSKYYVTII 306 L KLK + G + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 214 LDKLKAERERGITIDIALWKFETSKYYVTII 306 L KLK + G + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 321 QRFHQEHDHRNLS 359 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 20.6 bits (41), Expect = 8.7 Identities = 4/11 (36%), Positives = 7/11 (63%) Frame = -2 Query: 133 HHICRSSDQWW 101 HH+ ++ WW Sbjct: 88 HHLIKNKPNWW 98 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,103 Number of Sequences: 336 Number of extensions: 2396 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -