SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS304H07f
         (521 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory recept...    23   2.2  
AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory recept...    23   2.2  
EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive pep...    21   6.6  
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    21   8.7  

>AM292334-1|CAL23146.2|  390|Tribolium castaneum gustatory receptor
           candidate 13 protein.
          Length = 390

 Score = 22.6 bits (46), Expect = 2.2
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +1

Query: 214 LDKLKAERERGITIDIALWKFETSKYYVTII 306
           L KLK   + G  + +A  KF   K+YV I+
Sbjct: 78  LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108


>AM292333-1|CAL23145.2|  316|Tribolium castaneum gustatory receptor
           candidate 12 protein.
          Length = 316

 Score = 22.6 bits (46), Expect = 2.2
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = +1

Query: 214 LDKLKAERERGITIDIALWKFETSKYYVTII 306
           L KLK   + G  + +A  KF   K+YV I+
Sbjct: 4   LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34


>EF222292-1|ABN79652.1|  354|Tribolium castaneum cardioactive
           peptide receptor 2 protein.
          Length = 354

 Score = 21.0 bits (42), Expect = 6.6
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +3

Query: 321 QRFHQEHDHRNLS 359
           + FH+EHD R  S
Sbjct: 260 RHFHEEHDTRRAS 272


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 20.6 bits (41), Expect = 8.7
 Identities = 4/11 (36%), Positives = 7/11 (63%)
 Frame = -2

Query: 133 HHICRSSDQWW 101
           HH+ ++   WW
Sbjct: 88  HHLIKNKPNWW 98


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,103
Number of Sequences: 336
Number of extensions: 2396
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12573240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -