BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H06f (493 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.3 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 4.3 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 4.3 Identities = 10/38 (26%), Positives = 17/38 (44%) Frame = -1 Query: 460 CSYPLDAKMMKFMDSYSYNESKTMNRHLSFFNGIIPTL 347 CS L M++ D + + +L F G++P L Sbjct: 408 CSTRLHCTMIRHDDDSNQSSGTCYTLYLEFLGGLVPLL 445 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 4.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 124 DRGRTYKRILIGMEFVVCGIIL 189 D+GR Y+ LI EF+ C + L Sbjct: 606 DKGRRYRFRLINAEFLNCPVEL 627 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 454,703 Number of Sequences: 2352 Number of extensions: 8459 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -