BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H05f (477 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 26 3.4 SPAPB2B4.03 |cig2|cyc17|cyclin Cig2|Schizosaccharomyces pombe|ch... 25 5.9 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 25.8 bits (54), Expect = 3.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 32 RSSLLNTLKAKDACYKPFTASHAQTTSL 115 ++ LL+T ++ACY TAS Q + L Sbjct: 460 QAELLSTKMRQEACYLQLTASRTQCSDL 487 >SPAPB2B4.03 |cig2|cyc17|cyclin Cig2|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.0 bits (52), Expect = 5.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 104 FEHDLL*KVCSKRLLLSMYLEEKIVTHGSAT 12 F+HDLL SK +MYL +++ G T Sbjct: 299 FDHDLLRYPMSKIAAAAMYLSRRLLRRGPWT 329 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,535,539 Number of Sequences: 5004 Number of extensions: 24292 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -