Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS304H05f
         (477 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    23   7.2  
AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein p...    22   9.6  

>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 22.6 bits (46), Expect = 7.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -1

Query: 210 RWPVCCCSLLCC 175
           R P+CCC   CC
Sbjct: 544 RMPICCC--FCC 553


>AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein
           protein.
          Length = 357

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 14/57 (24%), Positives = 24/57 (42%), Gaps = 1/57 (1%)
 Frame = +2

Query: 32  RSSLLNTLKAKDACYKPFTASHAQTTSLKAMHTKEGRGLPIRT*TSSKQHRRLQ-QH 199
           +++  NT+ AK     P  ASH    +      K+ R   +   T +  H  ++ QH
Sbjct: 57  KATYANTVSAKTVAPTPQAASHTAAGNSGQKKKKKSRSRFLSAATPAPTHANVEDQH 113


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 399,697
Number of Sequences: 2352
Number of extensions: 6935
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 42095889
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)