BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304H01f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0238 + 21186072-21186883,21187315-21189346 29 3.0 01_06_1556 - 38222071-38222708,38222795-38222822,38222950-382230... 28 5.2 01_05_0175 - 18936752-18937621,18938855-18941641 27 6.9 >02_04_0238 + 21186072-21186883,21187315-21189346 Length = 947 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 365 CMFFLCLLPHNFCLGESILKILFLLES*RFP 273 CM +LCL P ++ + + IL ++ E FP Sbjct: 425 CMLYLCLFPEDYIISKDILVQQWIAEGFVFP 455 >01_06_1556 - 38222071-38222708,38222795-38222822,38222950-38223070, 38223206-38223318,38223424-38223506,38223868-38223930, 38224100-38224254,38224411-38224580,38225101-38225189, 38225304-38225496,38225655-38225779,38226069-38226475, 38226855-38226919,38227414-38227692,38227772-38227845, 38228241-38228292,38228366-38228473,38228871-38228972, 38229100-38229173,38229262-38229435,38229667-38229771, 38229867-38229977,38230364-38230487 Length = 1150 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/60 (21%), Positives = 28/60 (46%) Frame = +2 Query: 206 FILIWFSHGYHYQNWTKLKWDHTGSVSFLIKKESSKSIHPDKSYEVTNIKKTYSRIENLL 385 F++ W S +H+ W L+W H S ++ +K+ P + Y K + +++ + Sbjct: 387 FLVKWQSLSHHHDCWVPLEWLHV-SDPLRVQSYLNKNCLPKEVYSEDQRKLEWFEVDHAI 445 >01_05_0175 - 18936752-18937621,18938855-18941641 Length = 1218 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 217 LVFSWIPLSELD*IEMGSHGKRQLSNKKRIFKI 315 L F+WIP+ L I++ HGK ++ +K + ++ Sbjct: 1178 LSFAWIPVDYLARIKLRCHGKVRVEGQKPVERL 1210 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,379,372 Number of Sequences: 37544 Number of extensions: 200844 Number of successful extensions: 379 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -