BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304G12f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit ... 27 1.3 SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 27 1.3 SPCC31H12.05c |sds21||serine/threonine protein phosphatase Sds21... 27 2.2 SPAC22E12.17c |glo3||ARF GTPase activating protein|Schizosacchar... 25 5.2 SPCC338.16 |pof3||F-box protein Pof3|Schizosaccharomyces pombe|c... 25 5.2 SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|ch... 25 6.8 SPAPB8E5.09 |||AAA family ATPase Rvb1 |Schizosaccharomyces pombe... 25 6.8 SPBC776.02c |dis2|sds1, bws1|serine/threonine protein phosphatas... 25 6.8 >SPCC1919.14c |bdp1||transcription factor TFIIIB complex subunit Bdp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 507 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -1 Query: 308 VAQREPRVLDDEPGVGRQGYRFDRLQTIAF 219 +++ + L D+PG+GR+ RF L+ + F Sbjct: 185 ISETKMSALCDDPGIGRKSQRFIELEKMLF 214 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 27.5 bits (58), Expect = 1.3 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +3 Query: 138 EQIRDIGGQVDLECSVHYAQEFPVVWTKRDRLKTIESIPLSTNAGLIIKDSRFSLRHDEA 317 EQ+ D+ ++ L+ ++ +Q FP+ K D L+ + NA L+ + +L E Sbjct: 1088 EQVEDLNKEIALKAGINESQPFPIS-EKEDPLRQEVYVLKKQNAMLLTQLQSSNLNFAEI 1146 Query: 318 TA 323 T+ Sbjct: 1147 TS 1148 >SPCC31H12.05c |sds21||serine/threonine protein phosphatase Sds21|Schizosaccharomyces pombe|chr 3|||Manual Length = 322 Score = 26.6 bits (56), Expect = 2.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 461 IVRYDGGPPDLELHFSGDLVAYGHQHLALV 372 + Y G PPD F GD V G Q L ++ Sbjct: 71 LFEYGGYPPDANYLFLGDYVDRGKQSLEVI 100 >SPAC22E12.17c |glo3||ARF GTPase activating protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 486 Score = 25.4 bits (53), Expect = 5.2 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = -2 Query: 433 TWSSTSAAILLLMDISTWHWYQPASFS*ISLMESVNVAVASSW 305 TWSST+ I L +D S H S + + S V SW Sbjct: 33 TWSSTTFGIYLCLDCSAAHRNMGVHISFVRFLRS---TVLDSW 72 >SPCC338.16 |pof3||F-box protein Pof3|Schizosaccharomyces pombe|chr 3|||Manual Length = 577 Score = 25.4 bits (53), Expect = 5.2 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 225 DRLKTIESIPLSTNAGLIIKDSRFSLRHDE 314 D+L ES+PL+ + I++ +F H E Sbjct: 307 DKLFNAESVPLALKSLTFIRNQKFPFHHKE 336 >SPBC25H2.11c |||bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 979 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 261 STGVSIRSSSNDRVWSRQQETLEHNARNIPGLPGLRY 151 + G + + S + ++ R E N RN PG+P L Y Sbjct: 599 TAGSVLETESEEDLYFRDYSLFEIN-RNTPGVPSLMY 634 >SPAPB8E5.09 |||AAA family ATPase Rvb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 299 AAPRRGNGHIYALHQGYSRERRRLVPVPSADVHKQQD 409 A R G YA + E VP+P +VHK+++ Sbjct: 200 AVKRVGRSDAYATE--FDLEAEEYVPMPKGEVHKRKE 234 >SPBC776.02c |dis2|sds1, bws1|serine/threonine protein phosphatase PP1|Schizosaccharomyces pombe|chr 2|||Manual Length = 327 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 461 IVRYDGGPPDLELHFSGDLVAYGHQHLALV 372 + Y G PP+ F GD V G Q L ++ Sbjct: 74 LFEYGGFPPEANYLFLGDYVDRGKQSLEVI 103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,374,626 Number of Sequences: 5004 Number of extensions: 51175 Number of successful extensions: 156 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -