BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304G08f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY128419-1|AAM75012.1| 741|Drosophila melanogaster GH14073p pro... 29 5.1 AF239609-1|AAF63501.1| 741|Drosophila melanogaster SP1173 protein. 29 5.1 AE014296-1144|AAN12079.1| 741|Drosophila melanogaster CG10121-P... 29 5.1 AE014296-1143|AAN12078.1| 741|Drosophila melanogaster CG10121-P... 29 5.1 AE014296-1142|AAF50650.1| 741|Drosophila melanogaster CG10121-P... 29 5.1 AE014296-1141|AAN12077.1| 741|Drosophila melanogaster CG10121-P... 29 5.1 >AY128419-1|AAM75012.1| 741|Drosophila melanogaster GH14073p protein. Length = 741 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 240 LSFRPFTYEYF*LV*TKCTVGKVYTYIYLLFISNEITARPAH 115 L F TY++ +V C V +Y IY L ++ TA+P H Sbjct: 640 LEFWSCTYQWLAIV--ACVVALIYFGIYNLILAPRCTAKPQH 679 >AF239609-1|AAF63501.1| 741|Drosophila melanogaster SP1173 protein. Length = 741 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 240 LSFRPFTYEYF*LV*TKCTVGKVYTYIYLLFISNEITARPAH 115 L F TY++ +V C V +Y IY L ++ TA+P H Sbjct: 640 LEFWSCTYQWLAIV--ACVVALIYFGIYNLILAPRCTAKPQH 679 >AE014296-1144|AAN12079.1| 741|Drosophila melanogaster CG10121-PD, isoform D protein. Length = 741 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 240 LSFRPFTYEYF*LV*TKCTVGKVYTYIYLLFISNEITARPAH 115 L F TY++ +V C V +Y IY L ++ TA+P H Sbjct: 640 LEFWSCTYQWLAIV--ACVVALIYFGIYNLILAPRCTAKPQH 679 >AE014296-1143|AAN12078.1| 741|Drosophila melanogaster CG10121-PC, isoform C protein. Length = 741 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 240 LSFRPFTYEYF*LV*TKCTVGKVYTYIYLLFISNEITARPAH 115 L F TY++ +V C V +Y IY L ++ TA+P H Sbjct: 640 LEFWSCTYQWLAIV--ACVVALIYFGIYNLILAPRCTAKPQH 679 >AE014296-1142|AAF50650.1| 741|Drosophila melanogaster CG10121-PB, isoform B protein. Length = 741 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 240 LSFRPFTYEYF*LV*TKCTVGKVYTYIYLLFISNEITARPAH 115 L F TY++ +V C V +Y IY L ++ TA+P H Sbjct: 640 LEFWSCTYQWLAIV--ACVVALIYFGIYNLILAPRCTAKPQH 679 >AE014296-1141|AAN12077.1| 741|Drosophila melanogaster CG10121-PA, isoform A protein. Length = 741 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -3 Query: 240 LSFRPFTYEYF*LV*TKCTVGKVYTYIYLLFISNEITARPAH 115 L F TY++ +V C V +Y IY L ++ TA+P H Sbjct: 640 LEFWSCTYQWLAIV--ACVVALIYFGIYNLILAPRCTAKPQH 679 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,052,109 Number of Sequences: 53049 Number of extensions: 323844 Number of successful extensions: 314 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -