BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304G06f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 24 0.94 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 24 0.94 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 8.7 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 8.7 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 8.7 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.8 bits (49), Expect = 0.94 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 480 NWVPGPPSSXXXXXFIALNYLMTVQLFMKIRQYKNVY 370 +++PGPP + I Y +F ++R++ +Y Sbjct: 37 SYLPGPPVNDIISGNIPPLYTSAENIFKQLREWGRLY 73 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.8 bits (49), Expect = 0.94 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -3 Query: 480 NWVPGPPSSXXXXXFIALNYLMTVQLFMKIRQYKNVY 370 +++PGPP + I Y +F ++R++ +Y Sbjct: 37 SYLPGPPVNDIISGNILPLYTSAENIFKQLREWGRLY 73 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -1 Query: 101 QELLPGRPVQQEHSRWRQRRQELE 30 Q LLP E S+WR R +E Sbjct: 404 QSLLPAIVELAEDSKWRVRSAIIE 427 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 253 FSRPSVSFLRQIRFFPLHLLNKFADN 330 +SRP+ S+LR +F P ++N Sbjct: 44 YSRPNWSYLRTPQFEPQQFEVSLSEN 69 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 253 FSRPSVSFLRQIRFFPLHLLNKFADN 330 +SRP+ S+LR +F P ++N Sbjct: 64 YSRPNWSYLRTPQFEPQQFEVSLSEN 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,418 Number of Sequences: 336 Number of extensions: 1508 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -