BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 31 0.031 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 4.7 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 8.2 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 30.7 bits (66), Expect = 0.031 Identities = 14/55 (25%), Positives = 23/55 (41%) Frame = -3 Query: 417 HQSDINVISWNGKEPFIASGGDDGFLHIWDLRQFTNSTPVGTFKHHTAPVTSVEW 253 H+SD+ ++ WN +AS G + +W ++ V PVT W Sbjct: 63 HRSDVILVKWNEPYQKLASCDSSGIIFVW--IKYEGRWSVELINDRNTPVTHFSW 115 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 82 TLAQATTWRYCGXSTY 35 T+AQ TW CG +Y Sbjct: 183 TIAQPGTWNVCGDYSY 198 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/31 (22%), Positives = 18/31 (58%) Frame = -1 Query: 350 MVFYISGT*DSLQIVLQWVHSNITLHQLHQW 258 ++F ++ + S ++L + H N H++ +W Sbjct: 284 IMFMVASSVVSTILILNYHHRNSDTHEMSEW 314 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,908 Number of Sequences: 2352 Number of extensions: 9386 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -