BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F10f (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 24 2.0 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 3.5 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 6.0 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 24.2 bits (50), Expect = 2.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 192 PPNLDFTSEFSQSLHLLLKVLMLITE 115 PP+ FTS L L+LK + IT+ Sbjct: 457 PPHTCFTSSADYELALILKEIRFITD 482 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.4 bits (48), Expect = 3.5 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = +1 Query: 70 METHKLMMNLRDYGLF---RDEHQDFKEEMKRLRELRGKVK-VWRRLLDKKAE*KE 225 + T L+ D+ L R EHQ E ++R RG+++ + L ++ AE +E Sbjct: 599 LRTLNLLNRSTDHALLAQKRQEHQRLVRECDKIRNQRGQIENSIKELQERCAELRE 654 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 118 RDEHQDFKEEMKRLRELRGKVKVWRRLLDKKAE 216 R + +E+ + REL+ ++ RR L +KAE Sbjct: 140 RRDKAKVEEDQRHYRELKAADEIKRRELIQKAE 172 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 375,588 Number of Sequences: 2352 Number of extensions: 5451 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -