BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F09f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 25 2.0 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 24 2.7 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 4.7 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 343 DGRTYCQTCV*NYSLVNWRKPSASTRDCHYQLW 441 D +C+ C+ +L+N PSA+ ++ H +L+ Sbjct: 10 DCTKFCRFCLSEINLLNVIGPSAAEQESHAELF 42 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.2 bits (50), Expect = 2.7 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 4/31 (12%) Frame = +2 Query: 53 WNDDVAEAGSVVVETM--SLPQAAD--IPEI 133 W++D AEAG+ V E + ++P+A +PE+ Sbjct: 640 WDNDDAEAGAAVPEAVLDAIPEAMPEAVPEV 670 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 6 NFYLVIEKYQSWPRRTGM 59 +F V+ WPRRTGM Sbjct: 104 DFEKVLRSEGPWPRRTGM 121 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,118 Number of Sequences: 2352 Number of extensions: 11715 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -