BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F09f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68751-1|CAA92971.1| 210|Caenorhabditis elegans Hypothetical pr... 232 1e-61 >Z68751-1|CAA92971.1| 210|Caenorhabditis elegans Hypothetical protein T05E11.1 protein. Length = 210 Score = 232 bits (568), Expect = 1e-61 Identities = 110/136 (80%), Positives = 120/136 (88%) Frame = +2 Query: 113 AADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVE 292 A + PE+ LFG+WS V VSD+SL DYI VKEK AKYLPHSAGR+ +RFRKA CPIVE Sbjct: 17 ATEAPEVALFGKWSLQSVNVSDISLVDYIPVKEKSAKYLPHSAGRFQVRRFRKAACPIVE 76 Query: 293 RLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGR 472 RL NSLMMHGRNNGKKLM VRIVKHAFEII+LLTGENP+QVLV A+INSGPREDSTRIGR Sbjct: 77 RLANSLMMHGRNNGKKLMTVRIVKHAFEIIYLLTGENPVQVLVNAVINSGPREDSTRIGR 136 Query: 473 AGTVRRQAVDVSPLRR 520 AGTVRRQAVDV+PLRR Sbjct: 137 AGTVRRQAVDVAPLRR 152 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,272,365 Number of Sequences: 27780 Number of extensions: 260190 Number of successful extensions: 630 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -