BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F06f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP27G11.11c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 0.97 SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 9.0 >SPAP27G11.11c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 73 Score = 27.9 bits (59), Expect = 0.97 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 223 YIKTDCLSCKSLFLHS-EEPSSAFILCHLSLHYW*KLSIEVCES 95 Y KT LSC + ++ EE S F SLH LSI +CE+ Sbjct: 17 YSKTFLLSCYCVSIYRLEECSGRFKPSSYSLHLLKSLSIIICEN 60 >SPAC30C2.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 842 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -2 Query: 202 SCKSLFLHSEEPSSA 158 SCK++ +HSE+PS A Sbjct: 561 SCKAIDIHSEKPSFA 575 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,731,256 Number of Sequences: 5004 Number of extensions: 32597 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -