BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0344 + 21172101-21172233,21172332-21172402,21172492-211726... 31 0.74 02_04_0515 + 23582105-23583519,23583613-23583741,23583835-235839... 30 0.98 12_02_0980 - 25018107-25018469,25018792-25018938,25019028-25020110 29 1.7 05_07_0146 + 28018236-28018580,28018670-28018777,28018984-280191... 28 5.2 10_06_0172 + 11473892-11474896 27 6.9 >01_05_0344 + 21172101-21172233,21172332-21172402,21172492-21172653, 21172995-21173100,21174242-21174439,21174565-21174631, 21174868-21175051,21175145-21175324,21175408-21175587, 21176472-21176627,21177487-21178067,21178535-21178640, 21179152-21179331,21179620-21179892 Length = 858 Score = 30.7 bits (66), Expect = 0.74 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +3 Query: 210 RHETHER*AQQENFKHQTLDGLLINKQLWLAE-GLLSCQTKGGRYCGYPRSVRVDARLRD 386 R ET + AQ F + ++I KQ L+ C G RY GY R +A Sbjct: 203 RKETMGKCAQLAQFDEELYKAIIIVKQSGNDTFSLIKCNFSGMRYAGYSTCFRKEAGSHG 262 Query: 387 RWNIQGVFYSHK 422 R + G+F H+ Sbjct: 263 R-DTAGIFRVHQ 273 >02_04_0515 + 23582105-23583519,23583613-23583741,23583835-23583970, 23584051-23584139,23584236-23584347,23584427-23584533, 23584630-23584723 Length = 693 Score = 30.3 bits (65), Expect = 0.98 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +2 Query: 320 PNERRTLLRIPEECSGGCSSQRSMEHPRR 406 P+E RT R P E SGG S+RS E P + Sbjct: 76 PSEGRTEDREPGEVSGGSGSERSGERPMK 104 >12_02_0980 - 25018107-25018469,25018792-25018938,25019028-25020110 Length = 530 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 193 RTDRSGWCVQTLLSWCAAYHRG 128 R + + W ++ L WCAA HRG Sbjct: 186 RVETTRWSLEQLNRWCAALHRG 207 >05_07_0146 + 28018236-28018580,28018670-28018777,28018984-28019148, 28019269-28019736,28019823-28019936,28020038-28020715 Length = 625 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +1 Query: 97 NFDHDKHIFTGHGGKQR--TKKEASEHTNH 180 +FDH H HGG++R + EA H +H Sbjct: 275 HFDHHNHHHPIHGGRERGSSPAEADHHRHH 304 >10_06_0172 + 11473892-11474896 Length = 334 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 333 GRYCGYPRSVRVDARLRDRWNIQG 404 G Y GYP +VRVDA +N+ G Sbjct: 288 GAYPGYPGAVRVDAATGAGYNVVG 311 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,071,745 Number of Sequences: 37544 Number of extensions: 286991 Number of successful extensions: 761 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -