BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 7e-12 SB_24582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 33 0.19 SB_57023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 31 0.58 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 29 2.3 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_52316| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=8) 29 3.1 SB_21061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_4636| Best HMM Match : FGGY_N (HMM E-Value=7.3e-06) 28 4.1 SB_21915| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_55936| Best HMM Match : Paramecium_SA (HMM E-Value=0.56) 27 7.1 SB_11254| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_2894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_56655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 67.3 bits (157), Expect = 7e-12 Identities = 30/65 (46%), Positives = 42/65 (64%) Frame = +1 Query: 67 EAFFDEYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHNKK 246 E +FDEYDYYNFD +++ G+ K R+K+EA +TN F P GH RK++ K N E N+ Sbjct: 2 EPYFDEYDYYNFD--RNVVEGNTRKGRSKREACLNTNRFCPGGHERKVLEKYRNTEKNRA 59 Query: 247 TSNTK 261 +K Sbjct: 60 AKPSK 64 >SB_24582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 37.5 bits (83), Expect = 0.007 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +1 Query: 79 DEYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHS-RKIVTKLMNAEHNKKTSN 255 D+YD Y+FD H G K ++KKEAS++ N GHS RK + + E +K Sbjct: 5 DKYDDYDFDERLH--EGGARKGKSKKEASQNKN-VSTQGHSERKAAEYIQHGEDKRKEEK 61 Query: 256 TK 261 K Sbjct: 62 IK 63 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 32.7 bits (71), Expect = 0.19 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 257 VFEVFLLCSAFMSFVTIFLEC-PDGSKWLVCSDASFLVRCLP 135 VF V +L S + + L C P S L CS +SFL+ C P Sbjct: 1181 VFSVIILFITVFSIIILLLPCSPSSSFSLPCSPSSFLLPCSP 1222 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -1 Query: 257 VFEVFLLCSAFMSFVTIFLECPDGSKWLVCSDASFLVRCLP 135 VF + +L + L C S L CS +SFL+ C P Sbjct: 1191 VFSIIILLLPCSPSSSFSLPCSPSSFLLPCSPSSFLLPCSP 1231 >SB_57023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 388 Score = 31.1 bits (67), Expect = 0.58 Identities = 17/58 (29%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = +1 Query: 94 YNFDHDKHIFT-GHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHNKKTSNTKH 264 Y DHD + GH T + EH + GH T EH+ TS +H Sbjct: 327 YGHDHDTNTLRYGHDHDTNTLRYEQEHDTNTSRYGHDHDTNTLRYGHEHDTNTSRYEH 384 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 31.1 bits (67), Expect = 0.58 Identities = 17/58 (29%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = +1 Query: 94 YNFDHDKHIFT-GHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHNKKTSNTKH 264 Y DHD + GH T + EH + GH T EH+ TS +H Sbjct: 383 YGHDHDTNTLRYGHDHDTNTLRYEQEHDTNTSRYGHDHDTNTLRYGHEHDTNTSRYEH 440 >SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) Length = 1486 Score = 29.1 bits (62), Expect = 2.3 Identities = 22/76 (28%), Positives = 35/76 (46%) Frame = +1 Query: 124 TGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHNKKTSNTKH*MDC*SINNYG*Q 303 T GG++ +A E SG SRK+V K + + K+ S + + YG Sbjct: 1319 TATGGERTEVADAREKFTILVASGKSRKMVGKALTHDDVKRMSAVE-------VRKYGRG 1371 Query: 304 KDY*VAKRKEDAIADT 351 + +A R DA+AD+ Sbjct: 1372 YETALASRTSDALADS 1387 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +1 Query: 139 KQRTKKEA--SEHTNHFDPSGHSRKIVTKLMNAEHNKKTSN 255 K R K+A S++ H++ H R +V+KL+ HN +N Sbjct: 490 KDRMHKKAIKSKNQQHWEAFKHQRNLVSKLIKDSHNDYLNN 530 >SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 28.7 bits (61), Expect = 3.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 55 VNMSEAFFDEYDYYNFDHDKHI 120 V+ +AF+ +DYY F HD ++ Sbjct: 508 VSEGKAFYGSFDYYQFPHDSNL 529 >SB_52316| Best HMM Match : Fun_ATP-synt_8 (HMM E-Value=8) Length = 420 Score = 28.7 bits (61), Expect = 3.1 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 55 VNMSEAFFDEYDYYNFDHDKHI 120 V+ +AF+ +DYY F HD ++ Sbjct: 66 VSEGKAFYGSFDYYQFPHDSNL 87 >SB_21061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.3 bits (60), Expect = 4.1 Identities = 17/68 (25%), Positives = 31/68 (45%) Frame = +1 Query: 58 NMSEAFFDEYDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEH 237 +++E F + Y+ Y +D T G+ E + ++ + P SRK TK+ + Sbjct: 294 DIAEDFRERYEAYGYDQHDFPDTSSSGE-----ETLDDSDEWLPGQQSRKTSTKVASGAK 348 Query: 238 NKKTSNTK 261 +KT K Sbjct: 349 KRKTDRGK 356 >SB_4636| Best HMM Match : FGGY_N (HMM E-Value=7.3e-06) Length = 512 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 293 MASRRTIELPNERRTLLRIPEEC 361 + S RT +PN RTLL+IP C Sbjct: 461 LVSNRTDLIPNINRTLLKIPNYC 483 >SB_21915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 249 FKHQTLDGLLINKQLWLAEGLLSCQTKGGRYCGYPRSVRVDARL 380 ++ Q L G L QLW+ + SC ++ +CG + + L Sbjct: 54 YRQQLLSGTLT--QLWVVASMRSCTSRYTGFCGVKEEINLQQAL 95 >SB_55936| Best HMM Match : Paramecium_SA (HMM E-Value=0.56) Length = 581 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 319 QLNSPSASHSCLLISNPSSVW 257 Q S SASH C +SNP S W Sbjct: 528 QCVSASASHRCGRVSNPGSNW 548 >SB_11254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 85 YDYYNFDHDKHIFTGHGGKQR 147 YDY + D+D H + GKQR Sbjct: 17 YDYVDLDNDSHDYETMNGKQR 37 >SB_2894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 85 YDYYNFDHDKHIFTGHGGKQR 147 YDY + D+D H + GKQR Sbjct: 103 YDYVDLDNDSHDYETMNGKQR 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,442,249 Number of Sequences: 59808 Number of extensions: 346150 Number of successful extensions: 884 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 882 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -