BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F04f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g12820.1 68417.m02010 F-box family protein similar to F-box p... 29 1.4 At3g23190.1 68416.m02924 lesion inducing protein-related similar... 29 2.5 At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein... 28 4.4 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 28 4.4 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 27 7.7 >At4g12820.1 68417.m02010 F-box family protein similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana] Length = 442 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 304 SASHSCLLISNPSSVWCLKF 245 SAS SCL + NP+S W + F Sbjct: 96 SASESCLAVKNPTSPWIILF 115 >At3g23190.1 68416.m02924 lesion inducing protein-related similar to ORF, able to induce HR-like lesions [Nicotiana tabacum] Length = 216 Score = 28.7 bits (61), Expect = 2.5 Identities = 19/54 (35%), Positives = 27/54 (50%) Frame = +1 Query: 85 YDYYNFDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHNKK 246 YD+YN D+D+ FT K KE E T D G + + T ++N E +K Sbjct: 103 YDFYNRDYDRDHFTVFYTK---FKEFVEETTSAD-GGVAMSLYTSVVNEESRQK 152 >At4g19190.1 68417.m02832 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 595 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/55 (29%), Positives = 21/55 (38%) Frame = +1 Query: 100 FDHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTKLMNAEHNKKTSNTKH 264 +D D F G G + HT H DPS + V N+ K + KH Sbjct: 367 YDSDSLSFEG-SGSDSYRLSRRRHTKHVDPSASLKSEVYHQGNSHREKHYYDEKH 420 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 180 LRSVRAFEKDRHETHER*AQQENFKHQTLDGLLINKQLW 296 + S RAF + R+ ++ QQ++F T GL+ LW Sbjct: 127 INSQRAFNEIRYRHMQQQEQQQHFHFTTARGLVSGHSLW 165 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 103 DHDKHIFTGHGGKQRTKKEASEHTNHFDPSGHSRKIVTK 219 DH+K G ++R K + S+H +H HS+KI T+ Sbjct: 96 DHEKGASKQVGRRERAKPDPSKH-HHRSHLPHSKKIETE 133 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,312,367 Number of Sequences: 28952 Number of extensions: 229921 Number of successful extensions: 566 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 566 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -