BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304F01f (310 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 21 3.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 4.5 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 20 5.9 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 20 5.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 20 7.8 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 20 7.8 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.0 bits (42), Expect = 3.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -1 Query: 307 PVTPPGGCRAVSRDIR 260 PVTPP G + D+R Sbjct: 46 PVTPPQGENMLDMDLR 61 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.6 bits (41), Expect = 4.5 Identities = 5/13 (38%), Positives = 11/13 (84%) Frame = +1 Query: 94 YYNGNGVDSVETK 132 Y NG+G++S++ + Sbjct: 824 YVNGSGIESIQNR 836 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 20.2 bits (40), Expect = 5.9 Identities = 7/20 (35%), Positives = 9/20 (45%) Frame = -3 Query: 269 GHQDHHRGPAPRHSEKHSAS 210 GH H P H H+A+ Sbjct: 420 GHGHSHIHATPHHHHSHAAT 439 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 20.2 bits (40), Expect = 5.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 308 AGHPSGRVQSREQGHQDHHR 249 A P+G V + G+ D+HR Sbjct: 338 ANVPNGSVTNWVSGNHDNHR 357 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 19.8 bits (39), Expect = 7.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 298 PPGGCRAVSRDIRTTTEARRPGTARN 221 PP + T++E R+PG A N Sbjct: 492 PPYRLNKPLMSLITSSEVRQPGKAPN 517 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 19.8 bits (39), Expect = 7.8 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -1 Query: 208 KPTELSACCRERSETPRHRNKPSRPVWSRRSPHH 107 KPT L A E+ RH + + + R H+ Sbjct: 140 KPTPLGAVATEKMFVARHLAETPKNTSAVRYTHY 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,695 Number of Sequences: 438 Number of extensions: 1957 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6471036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -