BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304E12f (437 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0) 124 3e-29 SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026) 62 1e-10 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 44 7e-05 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 44 7e-05 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 44 7e-05 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 44 7e-05 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 44 7e-05 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 44 7e-05 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 40 9e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 39 0.002 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 39 0.002 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.006 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_57013| Best HMM Match : Pico_P2A (HMM E-Value=3.2) 25 2.7 SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) 28 3.9 SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_52318| Best HMM Match : Pox_A32 (HMM E-Value=0.066) 27 5.1 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) 27 5.1 SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) 27 5.1 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 27 5.1 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_52639| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 6.8 SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) 27 6.8 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 27 8.9 SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_42699| Best HMM Match : SIR2 (HMM E-Value=1.6e-12) 27 8.9 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 27 8.9 SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 27 8.9 SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) 27 8.9 >SB_33724| Best HMM Match : Ribosomal_L44 (HMM E-Value=0) Length = 113 Score = 124 bits (299), Expect = 3e-29 Identities = 60/106 (56%), Positives = 70/106 (66%), Gaps = 2/106 (1%) Frame = +3 Query: 15 SKMVNVPKQRRTYXXXXXXXXXXXX--SQYKKSKERHAAQGRRRYDRKQQGYGGQSKPIF 188 S +VNVPKQR+T+ +QYK K AQG+RRYDRKQ G+GGQ+KP+F Sbjct: 6 SPVVNVPKQRKTFCKGKKCRRHTLHKVTQYKTGKASLFAQGKRRYDRKQSGFGGQTKPVF 65 Query: 189 XXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMI 326 IVLR+EC CK R Q+ LKRCKHFELGGDKKRKGQMI Sbjct: 66 HKKAKTTKKIVLRMECTQCKYRKQMPLKRCKHFELGGDKKRKGQMI 111 >SB_37591| Best HMM Match : Ribosomal_L44 (HMM E-Value=0.026) Length = 39 Score = 62.5 bits (145), Expect = 1e-10 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 216 IVLRLECADCKVRSQVALKRCKHFELGGDKKRK 314 IVLR+EC CK R Q+ LKRCKHFELGGDKKRK Sbjct: 7 IVLRMECTQCKYRKQMPLKRCKHFELGGDKKRK 39 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.4 bits (100), Expect = 4e-05 Identities = 28/70 (40%), Positives = 35/70 (50%), Gaps = 11/70 (15%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW----------VPGPPSCRGLIY*KHLKLGSSVPFSSCHH-QAQS 283 KRRPVNCNTTHYRANW + PP CR I + G + +H ++ S Sbjct: 6 KRRPVNCNTTHYRANWSSTAVAAALELVDPPGCRNSIDGNGVSDGDGGSGDNDNHRKSDS 65 Query: 282 ACISSMQPVI 253 + I S Q I Sbjct: 66 SAIKSSQTEI 75 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 44.0 bits (99), Expect = 6e-05 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 11/45 (24%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW----------VPGPPSCR-GLIY*KHLKL 328 KRRPVNCNTTHYRANW + PP CR +IY ++ L Sbjct: 65 KRRPVNCNTTHYRANWSSTAVAAALELVDPPGCRNSMIYENYILL 109 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 9 KRRPVNCNTTHYRANW 24 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 633 KRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 44 KRRPVNCNTTHYRANW 59 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 6 KRRPVNCNTTHYRANW 21 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 46 KRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 1884 KRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 44 KRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 38 KRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 87 KRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 65 KRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 76 KRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 52 KRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 43.6 bits (98), Expect = 7e-05 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRANW 382 KRRPVNCNTTHYRANW Sbjct: 76 KRRPVNCNTTHYRANW 91 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 39.9 bits (89), Expect = 9e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 367 GGARYPIRPIVSRITIHWPSF 429 GGA PIRPIVSRITIHWP+F Sbjct: 36 GGA--PIRPIVSRITIHWPAF 54 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 367 GGARYPIRPIVSRITIHWPSF 429 GGA PIRPIVS ITIHWPSF Sbjct: 38 GGA--PIRPIVSHITIHWPSF 56 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRAN 385 KRRPVNCNTTHYRAN Sbjct: 83 KRRPVNCNTTHYRAN 97 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 429 KRRPVNCNTTHYRAN 385 KRRPVNCNTTHYRAN Sbjct: 26 KRRPVNCNTTHYRAN 40 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 37.1 bits (82), Expect = 0.006 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 385 IRPIVSRITIHWPSF 429 IRPIVSRITIHWPSF Sbjct: 18 IRPIVSRITIHWPSF 32 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.14 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 385 IRPIVSRITIHWPSF 429 +RP+VSRITIHW SF Sbjct: 33 LRPVVSRITIHWTSF 47 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.1 bits (67), Expect = 0.42 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +1 Query: 340 LLINKTPARGGARYPIRPIVSRITIHWPSF 429 L++ + P R + P +SRITIHWPSF Sbjct: 63 LVLERPPPRWSSN---SPYMSRITIHWPSF 89 >SB_57013| Best HMM Match : Pico_P2A (HMM E-Value=3.2) Length = 474 Score = 24.6 bits (51), Expect(2) = 2.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 252 RSQVALKRCKHFELGGD 302 +S++A RC H LGGD Sbjct: 419 QSRIAFPRCAHGPLGGD 435 Score = 22.2 bits (45), Expect(2) = 2.7 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 105 SKERHAAQGRRRYDRKQQGYGGQSKPIF 188 ++ RH + RRRY + G QS+ F Sbjct: 397 AERRHNGRDRRRYGQPDSGDVRQSRIAF 424 >SB_40225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1442 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 228 LECADCKVRSQVALKRCKHFELG 296 +EC +CK R +A C HF+ G Sbjct: 1113 IECPNCKFRYDLAKGGCMHFKCG 1135 >SB_29219| Best HMM Match : 7tm_1 (HMM E-Value=9.8e-06) Length = 863 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 385 LGTGPPLVPGSYLLEAFKIGIICPFLFLS 299 LG PL+PG L F I I+ P L +S Sbjct: 687 LGFFTPLIPGKISLTLFSIYILLPLLIMS 715 >SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 27.9 bits (59), Expect = 3.9 Identities = 19/70 (27%), Positives = 32/70 (45%) Frame = +1 Query: 4 AERTQKW*TYQNSAGRTAKNVNATKYTRYHSTKSPRKGTLPRVEDVMIVNSRVTVVSPNP 183 AE +W T + + +K + + K R T P + D+ +R+T VSP Sbjct: 1021 AESFHRWLTQRQFCAQYSKELASGKTNREWVTALPIV-----ISDINATKTRMTGVSPKD 1075 Query: 184 SSKRRQKPLR 213 + K R+ PL+ Sbjct: 1076 AIKLRRVPLK 1085 >SB_52318| Best HMM Match : Pox_A32 (HMM E-Value=0.066) Length = 716 Score = 27.5 bits (58), Expect = 5.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 162 NPAVYDHNVFYPGQRAFPWTF-CTVIPCVLCGIYIFCSTSCA 40 +P + DH VFYP P TF T+ P + I ++ ST+ A Sbjct: 167 HPILNDHGVFYPKALPHPLTFEITLAP--VSDIVVYSSTTPA 206 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_22849| Best HMM Match : Peptidase_A17 (HMM E-Value=0) Length = 1359 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -3 Query: 162 NPAVYDHNVFYPGQRAFPWTFCTVIPCVLCGIYIFCSTSCA 40 +P + DH VFYP P TF + + I ++ ST+ A Sbjct: 1172 HPILNDHGVFYPKALPHPLTF-EITLATVSDIVVYSSTTPA 1211 >SB_11815| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.002) Length = 1725 Score = 27.5 bits (58), Expect = 5.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 162 NPAVYDHNVFYPGQRAFPWTF-CTVIPCVLCGIYIFCSTSCA 40 +P + DH VFYP P TF T+ P + I ++ ST+ A Sbjct: 1243 HPILNDHGVFYPKALPHPLTFEITLAP--VSDIVVYSSTTQA 1282 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 400 SRITIHWPSF 429 SRITIHWPSF Sbjct: 2 SRITIHWPSF 11 >SB_52639| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 359 Score = 27.1 bits (57), Expect = 6.8 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -3 Query: 414 NCNTTHYRANWVPGPPSCRGLIY*KHLKLGSSV 316 N T Y +WV GP C+ ++Y + + + SSV Sbjct: 82 NMITEQYIRHWVFGPIVCKLVVYLQSVSVASSV 114 >SB_4035| Best HMM Match : DUF1279 (HMM E-Value=0.15) Length = 1575 Score = 27.1 bits (57), Expect = 6.8 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +1 Query: 88 YHSTKSPRK-GTLPRVEDV--MIVNSRVTVVSPNPSSKRRQK 204 Y + P+K G RV+++ ++ R T+ PN S RRQ+ Sbjct: 1011 YEAAWDPKKSGNTERVQELQGVVTTDRQTIDDPNTSESRRQE 1052 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 26.6 bits (56), Expect = 8.9 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%) Frame = +1 Query: 76 KYTRYHS-TKSPRKGTLPRVEDVMI--VNSRVTVVSPNPSSKRRQ 201 K TRY S T S R P ++ + +NS SP+PS+KR + Sbjct: 2061 KSTRYSSRTSSNRDSRTPPADEKIRADINSNEVQSSPSPSTKREE 2105 >SB_55929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 26.6 bits (56), Expect = 8.9 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -2 Query: 127 WAACLSLDFLYCDTLCTLWHLHFLQYVLRCFG 32 W L F+ C TLC W + Y R G Sbjct: 283 WIGAWWLGFVICGTLCIFWSIWLFGYPKRIPG 314 >SB_42699| Best HMM Match : SIR2 (HMM E-Value=1.6e-12) Length = 501 Score = 26.6 bits (56), Expect = 8.9 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 102 KSKERHAAQGRRRYDRKQQGY 164 K K+RHA Q YD+K Q Y Sbjct: 471 KQKDRHARQLGINYDKKHQNY 491 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 26.6 bits (56), Expect = 8.9 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -2 Query: 388 ELGTGPPLVPGSYLLEAFKIGIICPF---LFLSPPSSKCLHLFNATC 257 +L GP P S ++ + + CP +F +P CLH F C Sbjct: 124 DLDLGP--TPDSPMMPGSNVNLFCPLCHEMFANPRLLPCLHTFCKRC 168 >SB_30079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 877 Score = 26.6 bits (56), Expect = 8.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 252 RSQVALKRCKHFELGGDKKR 311 +S++A RC H LGGD +R Sbjct: 495 QSRIASPRCAHRPLGGDSRR 514 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 26.6 bits (56), Expect = 8.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 325 IICPFLFLSPPSSKCLHLFNATCDLTLQSAHSR 227 I+C F +P +KCLH F C L +S+ Sbjct: 246 IMCRKTFKNPVVTKCLHYFCEACALQHYKKNSK 278 >SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) Length = 399 Score = 26.6 bits (56), Expect = 8.9 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 Query: 138 VFYPGQRAFPWTFCTVIPCVLCGIYIFCSTSCAVLV 31 VFYP P V+ C+ + + C C +LV Sbjct: 105 VFYPPSNGLPVFTLLVMDCLCFTLLVMCYLCCTLLV 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,986,791 Number of Sequences: 59808 Number of extensions: 302969 Number of successful extensions: 1134 Number of sequences better than 10.0: 53 Number of HSP's better than 10.0 without gapping: 1083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1133 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 847047381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -